SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1U7EV65 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U7EV65
Domain Number 1 Region: 4-98
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000000988
Family MarR-like transcriptional regulators 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1U7EV65
Sequence length 257
Comment (tr|A0A1U7EV65|A0A1U7EV65_NATPD) ArNOG05395 family transcription regulator {ECO:0000313|EMBL:CAI48905.1} KW=Complete proteome; Reference proteome OX=348780 OS=NBRC 14720 / NCIMB 2260 / Gabara) (Halobacterium pharaonis). GN=NP_1628A OC=Natronomonas.
Sequence
MVDVLDNKRSATKFRVLVEIADRQPAVNQGEIADAVGVTSQAVSEYIRELVDEGFVEKEA
RSRYRVTKEGVDWLFQQAADVSRFAEHVTEDVLGSMQEDAAFAADDIAAGETVSLSISDG
LLYATPGDSGPATGVATTDAETGDVVGVTGFAGIIDLDPGSVTVFQVPPIRSGDPSGSPE
LADTAADADVVAAAGVEGVAALRDVDADPDVTFAAGEVAADAAGRGLDVVVVATTDLAGR
VTDALRDAGIAYEVDDI
Download sequence
Identical sequences A0A1U7EV65
gi|76801464|ref|YP_326472.1| 348780.NP1628A WP_011322539.1.57290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]