SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1U7EV94 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U7EV94
Domain Number 1 Region: 1-148
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 9.29e-21
Family N-acetyl transferase, NAT 0.0061
Further Details:      
 
Weak hits

Sequence:  A0A1U7EV94
Domain Number - Region: 201-229
Classification Level Classification E-value
Superfamily RNA polymerase subunits 0.00994
Family RBP12 subunit of RNA polymerase II 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1U7EV94
Sequence length 240
Comment (tr|A0A1U7EV94|A0A1U7EV94_NATPD) GNAT family acetyltransferase {ECO:0000313|EMBL:CAI48910.1} KW=Complete proteome; Reference proteome OX=348780 OS=NBRC 14720 / NCIMB 2260 / Gabara) (Halobacterium pharaonis). GN=NP_1638A OC=Natronomonas.
Sequence
MEIREATADDGPAVRSVTLRSMEASYSLSPSTIESAIQQWYGVDNFAEKLNDDEVLLLVA
EKDGEPVAFSESALVDDRGDIHWIHVAAMHRGEGIGQAMYEETRSQLEDAGAETIRGLVL
SMNTEGNRFWENRGLQKAGEGTVEIDGTAFVENIYVDEDAVELQPVVVDGQELYIDRNDS
SRGSSGPFYTVYTDEEGENHHSYYCGSCESLVTSMDTMGRLSCEECGNQLKPTRWDAAYM
Download sequence
Identical sequences A0A1U7EV94
WP_011322544.1.57290 gi|76801469|ref|YP_326477.1| 348780.NP1638A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]