SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1U7EVR9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U7EVR9
Domain Number 1 Region: 129-205
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000000361
Family Hypothetical protein PH1932 0.057
Further Details:      
 
Domain Number 2 Region: 63-115
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000662
Family FaeA-like 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1U7EVR9
Sequence length 214
Comment (tr|A0A1U7EVR9|A0A1U7EVR9_NATPD) ArsR family transcription regulator {ECO:0000313|EMBL:CAI49148.1} KW=Complete proteome; Reference proteome OX=348780 OS=NBRC 14720 / NCIMB 2260 / Gabara) (Halobacterium pharaonis). GN=NP_2114A OC=Natronomonas.
Sequence
MDRQHVAVLVAVCMALALVPAGVAAAEEPAEAVAAATGPTVDATVTDRYRAGASAGLSRV
DTDGVLEQPTRATIYEAIDESPGIDLAGLAAAADVTKSTARYHVDVLRDAGLVAGVEVAG
ALRFAPAELDAEVAGVLETDAPGTVLTAVADHEPASVRTLAEATDRAPSTVSHHLSELEA
RGLVERERRGEAVLTSLAPPARDALGAPPATADD
Download sequence
Identical sequences A0A1U7EVR9
348780.NP2114A gi|76801701|ref|YP_326709.1| WP_011322776.1.57290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]