SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1U7EW31 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1U7EW31
Domain Number - Region: 11-82
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0177
Family Lrp/AsnC-like transcriptional regulator N-terminal domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1U7EW31
Sequence length 100
Comment (tr|A0A1U7EW31|A0A1U7EW31_NATPD) Homolog to phage PhiH1 repressor protein {ECO:0000313|EMBL:CAI49272.1} KW=Complete proteome; Reference proteome OX=348780 OS=NBRC 14720 / NCIMB 2260 / Gabara) (Halobacterium pharaonis). GN=NP_2362A OC=Natronomonas.
Sequence
MTIRRNAGWQDRLDERILELLDEEPWSVPGMMTVEIPLNVTEQQIRERCLRMADIGLVSV
EPDNGWMVQLTTEGRLYLEGDLDAELYPHPRHPKRLKESL
Download sequence
Identical sequences A0A1U7EW31
WP_011322898.1.57290 gi|76801824|ref|YP_326832.1| 348780.NP2362A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]