SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1U7EWL8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U7EWL8
Domain Number 1 Region: 8-70
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000247
Family TrmB-like 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1U7EWL8
Sequence length 118
Comment (tr|A0A1U7EWL8|A0A1U7EWL8_NATPD) Probable transcription factor (Homolog to RNA polymerase III subunit RPC34) {ECO:0000313|EMBL:CAI49472.1} KW=Complete proteome; Reference proteome OX=348780 OS=NBRC 14720 / NCIMB 2260 / Gabara) (Halobacterium pharaonis). GN=NP_2762A OC=Natronomonas.
Sequence
MSTATDADLSEIEREGLELIRETGGIHQSDFWKELDVDSRKGSRILDSLEEEGLVEREET
VYDGHNTYLVTPVRDPKDLDFSLLMAGDMLSPFVGDEEIDAQSDAFSQWVMNLAYEEY
Download sequence
Identical sequences A0A1U7EWL8
348780.NP2762A gi|76802023|ref|YP_327031.1| WP_011323097.1.57290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]