SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1U7EWP1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U7EWP1
Domain Number 1 Region: 30-99
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000129
Family Cold shock DNA-binding domain-like 0.0077
Further Details:      
 
Domain Number 2 Region: 215-290
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000371
Family Anticodon-binding domain 0.0094
Further Details:      
 
Weak hits

Sequence:  A0A1U7EWP1
Domain Number - Region: 327-655
Classification Level Classification E-value
Superfamily DHH phosphoesterases 0.00022
Family Exonuclease RecJ 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1U7EWP1
Sequence length 693
Comment (tr|A0A1U7EWP1|A0A1U7EWP1_NATPD) DHH/RecJ family phosphoesterase {ECO:0000313|EMBL:CAI49528.1} KW=Complete proteome; Reference proteome OX=348780 OS=NBRC 14720 / NCIMB 2260 / Gabara) (Halobacterium pharaonis). GN=NP_2874A OC=Natronomonas.
Sequence
MGNCIICGTSTDGLVCDVHQEDVLFEFTGNEPSQLTPGRFYKGTVDGYAEFGVFINIGNV
TGLLHRSKLDQRIESLDWDEGDEVSVQVNNVRDNGDIDLDSSIRQTADEFRGMLVQTPDG
EHLPDAADDDEADADEQTGGSPESSDDGPTTQEPSVDEQTGGNPSDPELAEMATESDEDD
EAAAEAEEAEAGDVDAESDIDRVAVETLRDRVGDVVRLEGVVASVRQTSGPTVFELRDET
GIVDCAAFVEAGVRAYPEIETDDVVRLDGEVRLRRDEIQVETDSLVALEDDAREDVESRM
DAAIENRARPESVEPLADDDAVSAITDDIADAATEIRRAVLESRPVVVRHDATTDGYVAG
AAIERAVLPLIRDEYESADAVYHYFDRRPLEDGVYDMDDATKDVTRMLDDRERHDEKLPL
FVFAAAGSTAASTDGLELLDVYDAPRVVLDGRPVDDAVDDEIDAPVTADGRTSATVAAAV
AAAVNGDVRADLEHLPAVSYWDETPTVYTDLATGAGFDEETVEQLREAIALEAFYQSYED
KRQLIIDLLFGEQTGLAAQVSEQFDTKLEAELETATTNLDERTVDGYDVTVLDTDAYTHT
YDFPPTRLLLDELSRRLDADAVVGVATDELHLRAADDIDISAVADTVAEAVPNAGVSDPG
AREPKLEFLAGKRDAVIDAVVDAVAEQVTAPSA
Download sequence
Identical sequences A0A1U7EWP1
WP_011323153.1.57290 gi|76802079|ref|YP_327087.1| 348780.NP2874A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]