SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1U7EX82 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U7EX82
Domain Number 1 Region: 44-137
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000333
Family TrmB-like 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1U7EX82
Sequence length 162
Comment (tr|A0A1U7EX82|A0A1U7EX82_NATPD) TrmB family transcription regulator {ECO:0000313|EMBL:CAI49776.1} KW=Complete proteome; Reference proteome OX=348780 OS=NBRC 14720 / NCIMB 2260 / Gabara) (Halobacterium pharaonis). GN=NP_3370A OC=Natronomonas.
Sequence
MATDKSSDDEGESTAGDSDGVRDRLEQEAERAAEQFDDGIVDLLSWVLDTETRARIYVFL
RQNPGSTSEEIAEGTGLYPSTVREALAGLHEEGRLERQKRDADGAGNNPYEYTAMAPSEL
VGDAVGEIQDELNTVFNLDSHLGVCEDDDTEPVTITVERDDP
Download sequence
Identical sequences A0A1U7EX82
gi|76802323|ref|YP_327331.1| 348780.NP3370A WP_011323396.1.57290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]