SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1U7EXW1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U7EXW1
Domain Number 1 Region: 18-78
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000114
Family CAP C-terminal domain-like 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1U7EXW1
Sequence length 118
Comment (tr|A0A1U7EXW1|A0A1U7EXW1_NATPD) Homolog to phage PhiH1 repressor protein {ECO:0000313|EMBL:CAI50039.1} KW=Complete proteome; Reference proteome OX=348780 OS=NBRC 14720 / NCIMB 2260 / Gabara) (Halobacterium pharaonis). GN=NP_3896A OC=Natronomonas.
Sequence
MRKQGDWMANWDDRFLEFAYDHGGATPKRIADNEHVHVSRQYVAKRLRELSDHGLLNKIG
RGSYTITKKGKYYLAGAYDAEKDEFLEYELRNYEWLILESEDKIEDFRSWFNDRSSAP
Download sequence
Identical sequences A0A1U7EXW1
WP_011323656.1.57290 348780.NP3896A gi|76802583|ref|YP_327591.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]