SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1U7EXX5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U7EXX5
Domain Number 1 Region: 67-164
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000284
Family MarR-like transcriptional regulators 0.081
Further Details:      
 
Weak hits

Sequence:  A0A1U7EXX5
Domain Number - Region: 2-61
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000196
Family MarR-like transcriptional regulators 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1U7EXX5
Sequence length 169
Comment (tr|A0A1U7EXX5|A0A1U7EXX5_NATPD) ArsR family transcription regulator {ECO:0000313|EMBL:CAI50059.1} KW=Complete proteome; Reference proteome OX=348780 OS=NBRC 14720 / NCIMB 2260 / Gabara) (Halobacterium pharaonis). GN=NP_3936A OC=Natronomonas.
Sequence
MSDTRARVKSHVESNPGVHFNAISRELDIATGQTQYHIRKLLRENRLTSMELCGRTHYFP
LGYSEHEQAGFALLRRETTRELVVLLLDEGPMAPDDLATEADIARSTVEWHLSNLVDCEL
AEKQYEGRSVRVHVTEPELLRELLVEIDPTLPDRLVDRFSRLVDSLLEP
Download sequence
Identical sequences A0A1U7EXX5
348780.NP3936A WP_011323676.1.57290 gi|76802603|ref|YP_327611.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]