SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1U7EY19 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U7EY19
Domain Number 1 Region: 65-146
Classification Level Classification E-value
Superfamily Dimeric alpha+beta barrel 0.00000000000000362
Family Lrp/AsnC-like transcriptional regulator C-terminal domain 0.0042
Further Details:      
 
Domain Number 2 Region: 6-59
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000264
Family Lrp/AsnC-like transcriptional regulator N-terminal domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1U7EY19
Sequence length 162
Comment (tr|A0A1U7EY19|A0A1U7EY19_NATPD) Lrp/AsnC family transcription regulator {ECO:0000313|EMBL:CAI50104.1} KW=Complete proteome; Reference proteome OX=348780 OS=NBRC 14720 / NCIMB 2260 / Gabara) (Halobacterium pharaonis). GN=NP_4026A OC=Natronomonas.
Sequence
MDRADELLELLCENARYSTADLARLTDSDEDEVEATIEELEAEGIIQGYTAVVDWDAAGD
ERVRAHVELNVTLDRETSYRDVAERLAGFSEIQDLRLVSGDYDFALEVEGENMREVSKFI
SDKVAPVPEITQTVTHYIMENYKQGGYRFDDDTDDDRLSVTP
Download sequence
Identical sequences A0A1U7EY19
348780.NP4026A WP_011323720.1.57290 gi|76802647|ref|YP_330742.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]