SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1U7EYI5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U7EYI5
Domain Number 1 Region: 66-127
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000348
Family F93-like 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1U7EYI5
Sequence length 163
Comment (tr|A0A1U7EYI5|A0A1U7EYI5_NATPD) PadR family transcription regulator {ECO:0000313|EMBL:CAI50313.1} KW=Complete proteome; Reference proteome OX=348780 OS=NBRC 14720 / NCIMB 2260 / Gabara) (Halobacterium pharaonis). GN=NP_4444A OC=Natronomonas.
Sequence
MSSQGNVEPTLERLVTELGDGDATRDDADPAARTEAVVTEASETLFEGGTLHVDDGLIKQ
SLPELLLLLVGLRSTDTHGKGIMEDLSRFFGAQLSPGTVYPMLHDLEADDLLEMRELVQT
KEYTIDDTEAVRGEIQAAMQQHLALGLVFSRALDEIDVDEMDD
Download sequence
Identical sequences A0A1U7EYI5
348780.NP4444A WP_011323928.1.57290 gi|76802855|ref|YP_330950.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]