SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1U7EYN2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U7EYN2
Domain Number 1 Region: 1-63
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3e-17
Family Cold shock DNA-binding domain-like 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1U7EYN2
Sequence length 64
Comment (tr|A0A1U7EYN2|A0A1U7EYN2_NATPD) Cold shock protein {ECO:0000313|EMBL:CAI50367.1} KW=Complete proteome; Reference proteome OX=348780 OS=NBRC 14720 / NCIMB 2260 / Gabara) (Halobacterium pharaonis). GN=NP_4552A OC=Natronomonas.
Sequence
MAKGEVDFFNDTGGYGFIDTDESDEDVFFHMEDIGGPDLEEGQEVEFDIEQADKGPRAKN
LTRL
Download sequence
Identical sequences A0A1U7EYN2
gi|76802909|ref|YP_331004.1| 348780.NP4552A WP_011323982.1.57290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]