SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1U7EYN6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1U7EYN6
Domain Number - Region: 185-246
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000109
Family Lrp/AsnC-like transcriptional regulator N-terminal domain 0.038
Further Details:      
 
Domain Number - Region: 11-131
Classification Level Classification E-value
Superfamily Xylose isomerase-like 0.0179
Family IolI-like 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1U7EYN6
Sequence length 352
Comment (tr|A0A1U7EYN6|A0A1U7EYN6_NATPD) Siroheme decarboxylase AhbB {ECO:0000313|EMBL:CAI50340.1} KW=Complete proteome; Reference proteome OX=348780 OS=NBRC 14720 / NCIMB 2260 / Gabara) (Halobacterium pharaonis). GN=NP_4498A OC=Natronomonas.
Sequence
MSETAGLDRLDRAVINAYQGGFPVVESPFEPAAEALADHGVDVTATELLKRVQTLDEEGV
LTRFGALINAAEIGGAATLVAMHAPEDRFEAVAEQVNSHREVAHNYRREHPHLNMWFVVS
VADADAVERVLADIEDETGQETYNLPKQQEFRVEAKFLVDGPIPDGDVDLSDLGPDASPT
DRGTLTPEERDLVVEIQDGLPVTETPYADVAAELGVDTDWVLRTIQRFNESGKIRRVGVI
PNHYALGYTENGMTVWSVPDEKLDEVGPEVAGLDFVTHCYERPRHEGVWPYNFFAMTHGR
SEDESKRRIQQVKSTMEEYWDVGDDDWDSLFSTEILKKTGIRLDERATANTE
Download sequence
Identical sequences A0A1U7EYN6
348780.NP4498A WP_011323955.1.57290 gi|76802882|ref|YP_330977.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]