SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1U7EYV6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U7EYV6
Domain Number 1 Region: 20-90
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000017
Family ROK associated domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1U7EYV6
Sequence length 208
Comment (tr|A0A1U7EYV6|A0A1U7EYV6_NATPD) TrmB family transcription regulator {ECO:0000313|EMBL:CAI50435.1} KW=Complete proteome; Reference proteome OX=348780 OS=NBRC 14720 / NCIMB 2260 / Gabara) (Halobacterium pharaonis). GN=NP_4688A OC=Natronomonas.
Sequence
MPPRSVSKTPSQDLEAGINQLATVGRLLEHPALARVYVYACYYGPATRPQIKEALAIPKT
TVYDHVETLEALGIVTLEGDRPVEVTAEPLQITTDGIVVTPTILHAVALQEVDEDVSYFV
ERYGVGKVAAAVRQAGLHYAGQITQRMVADPLDIPTGEAISIVLALRPALAVGQEYDPHF
DVIFPDIAGDIEFETDLDVAAPLPNSES
Download sequence
Identical sequences A0A1U7EYV6
gi|76802976|ref|YP_331071.1| WP_011324049.1.57290 348780.NP4688A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]