SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1U7EZ18 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U7EZ18
Domain Number 1 Region: 1-53
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000000627
Family Lrp/AsnC-like transcriptional regulator N-terminal domain 0.0045
Further Details:      
 
Domain Number 2 Region: 58-133
Classification Level Classification E-value
Superfamily Dimeric alpha+beta barrel 0.0000000000563
Family Lrp/AsnC-like transcriptional regulator C-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1U7EZ18
Sequence length 137
Comment (tr|A0A1U7EZ18|A0A1U7EZ18_NATPD) Lrp/AsnC family transcription regulator {ECO:0000313|EMBL:CAI50505.1} KW=Complete proteome; Reference proteome OX=348780 OS=NBRC 14720 / NCIMB 2260 / Gabara) (Halobacterium pharaonis). GN=NP_4828A OC=Natronomonas.
Sequence
MDDLDREILAILRRDSRTPYTEIAEQVGTSEGTVRNRVERLLEEGIIERFTIATRTGNVK
AMIEISVAVDVDTGDIADRMTEWREVDFVWQVSGEEDVVVVVDTTDTGTLNDLITRAREL
DEVVSTKTRLILAERRG
Download sequence
Identical sequences A0A1U7EZ18
gi|76803044|ref|YP_331139.1| WP_011324117.1.57290 348780.NP4828A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]