SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1U7EZI9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U7EZI9
Domain Number 1 Region: 27-122
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000952
Family TrmB-like 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1U7EZI9
Sequence length 132
Comment (tr|A0A1U7EZI9|A0A1U7EZI9_NATPD) TrmB family transcription regulator {ECO:0000313|EMBL:CAI50727.1} KW=Complete proteome; Reference proteome OX=348780 OS=NBRC 14720 / NCIMB 2260 / Gabara) (Halobacterium pharaonis). GN=NP_5272A OC=Natronomonas.
Sequence
MDPEPDPARFRDLMLDGEPGFEEVLRCVFGIQNHEARLYLELLEAPDSTVTELAETVDRD
RSNVNRGLATLLEKGLADRRRRLLDSGGHVYQYRATDPETARELMHETLDEWAAYVHERI
DEFPCATDGQSR
Download sequence
Identical sequences A0A1U7EZI9
WP_011324336.1.57290 gi|76803263|ref|YP_331358.1| 348780.NP5272A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]