SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1U7EZL9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1U7EZL9
Domain Number - Region: 376-418
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000526
Family Transcriptional regulator IclR, N-terminal domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1U7EZL9
Sequence length 550
Comment (tr|A0A1U7EZL9|A0A1U7EZL9_NATPD) Homolog to HGPV1-ORF14 {ECO:0000313|EMBL:CAI50757.1} KW=Complete proteome; Reference proteome OX=348780 OS=NBRC 14720 / NCIMB 2260 / Gabara) (Halobacterium pharaonis). GN=NP_5332A OC=Natronomonas.
Sequence
MNAELIEPAWHEVAVNLIFGDDGHCCSHGLEPFYAAERIVRNNGGSKRGRCQVNGHTVSL
QLYYQDSGIGSLNHPSTDLDTIREFRISWEIVDEDDDVGERSGNIHIAPRTPKMTDTNGD
SISTPPDLTGVNCTVKGSNFPLEEYDALLHRATSALGFNERYFSPDRIHQEYSNIQDAAR
YVRLIRNETGTIHAVDGVIARISNLLASDRSGYRKHVADDTEAPGYYHTATIGPKRASEL
VDQHHLPKEIKHYLPRESDSLDPENPVYHPKLEASLQVSRVDGPVQWSERSRVARELDEV
LLNVLRWEDFPVTDDELEAGDRDGGDPPGGRGPFVEDEYFGAETSRRQRRLLDDPTPELQ
DQQESLVMKHLAGGFEDSDADVLDALVTDGGEVSPQDIAEQKDWHVETIYKAVDRLEDII
DHSYGELSLRSHHIAEKVCEYVQSARRSAVDAAETLARSLEHEVGLELANDALVEWVDRF
GVDVEDRRDAQLALRFGRVEMTREEFSVALTTGLHQWMQAGWKRERFLEAEVEVRLDGGR
YQMRAYDLMG
Download sequence
Identical sequences A0A1U7EZL9
348780.NP5332A gi|76803293|ref|YP_331388.1| WP_011324366.1.57290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]