SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1U7Q9A3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U7Q9A3
Domain Number 1 Region: 74-121
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000183
Family TSP-1 type 1 repeat 0.0038
Further Details:      
 
Domain Number 2 Region: 35-76
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000019
Family Somatomedin B domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1U7Q9A3
Sequence length 264
Comment (tr|A0A1U7Q9A3|A0A1U7Q9A3_MESAU) somatomedin-B and thrombospondin type-1 domain-containing protein {ECO:0000313|RefSeq:XP_005066825.1} KW=Complete proteome; Reference proteome OX=10036 OS=Mesocricetus auratus (Golden hamster). GN=Sbspon OC=Muroidea; Cricetidae; Cricetinae; Mesocricetus.
Sequence
MRTLWMVLCALARLWPGALAGCTEAGRCCPGRDPACFARGWRVDRVYGTCFCDQACRLTG
DCCFDYDRACPARPCFVGEWSPWSGCAGQCRPTTRVRRRLVQQEPLNGGAPCPPLEERAG
CLEYSSSQGQDCGHSFVPAFITSSAFNKKRAIQATSPQWSTHTEDAGYCMEFKTESLTPH
CALDNRPLTRWMQYLREGYTVCVDCQPPAMNSVSLRCSGDGLDSDGNQSLRWQAIGNPRC
QGTWKKVRRVEHCSCPEVHHFIFI
Download sequence
Identical sequences A0A1U7Q9A3
XP_005066825.1.91757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]