SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1U7QA57 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U7QA57
Domain Number 1 Region: 1114-1289
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.35e-42
Family BCR-homology GTPase activation domain (BH-domain) 0.00062
Further Details:      
 
Domain Number 2 Region: 675-790
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 9.94e-36
Family Pyk2-associated protein beta ARF-GAP domain 0.0015
Further Details:      
 
Domain Number 3 Region: 439-562
Classification Level Classification E-value
Superfamily PH domain-like 2.44e-24
Family Pleckstrin-homology domain (PH domain) 0.0000141
Further Details:      
 
Domain Number 4 Region: 909-1028
Classification Level Classification E-value
Superfamily PH domain-like 7.87e-21
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Domain Number 5 Region: 1414-1555
Classification Level Classification E-value
Superfamily PH domain-like 1.31e-18
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 
Domain Number 6 Region: 5-75
Classification Level Classification E-value
Superfamily SAM/Pointed domain 8.38e-17
Family SAM (sterile alpha motif) domain 0.0000519
Further Details:      
 
Domain Number 7 Region: 576-674
Classification Level Classification E-value
Superfamily PH domain-like 4.88e-16
Family Pleckstrin-homology domain (PH domain) 0.02
Further Details:      
 
Domain Number 8 Region: 1005-1105
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000322
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1U7QA57
Sequence length 1693
Comment (tr|A0A1U7QA57|A0A1U7QA57_MESAU) arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 2 isoform X1 {ECO:0000313|RefSeq:XP_005074448.1, ECO:0000313|RefSeq:XP_012972011.1, ECO:0000313|RefSeq:XP_012972012.1} KW=Complete proteome; Reference proteome OX=10036 OS=Mesocricetus auratus (Golden hamster). GN=Arap2 OC=Muroidea; Cricetidae; Cricetinae; Mesocricetus.
Sequence
MSSVSEVNVDIRDFLMSINLEQYLLHFREFGFYTVKDCTSINDSVLHQIGISPTGHRRRI
LKQLQMIFSKMQDIPIYANVHKTKNGNTSKEHQNPPSSSNTACVELSDCISVHRPGLTPV
ETVTMSTFGVGNCQSPKSHDKPSLPPEEELHQNVDSSQDSLFGSVNVKIDPLATQKVMDC
TAGEGQTEKINLISESSSVAFSTNPECLPSVDYPASETHSGSGTNGLSEGSPASPFFQFQ
GEMVVNDLYVPSSPAHTPMRSRSKLVSRPSRSFMLRHRPVPEIPGSTKAISGSYFRDRRS
ATTSAAKPLTLKNSNEDNSTSIFPYGETFLFQRLESSKKRSIKNEFWAHEDTVKEDTGTT
NSISTKSSIYDNSKEKVNEDKVEDIWIPREDKNNLPKDSASESEYSTVEECFQSLRRKNS
KASKSRTQKAFYLDPFNRHSYPLSSTSGNTDSSAISNAISPYACFYGSSAAKVKSGWLDK
LSPQGKRMFQKRWVKFDGLSISYYNNEREMYSKGIIPLTAIATVRAQGDNKFEIVTTQRT
FVFRVEKEEERNDWISILLSALKSPSLTAQLQATMAPEKCGYLELRGYKAKIFTVLRGNS
VWLCKNEQDFKSGLGITIIPMNVANVKQVDRAVKQSFEIITPYRSFSFTAESEKEKQDWI
EAVQQSIAETLSDYEVAEKIWFNESNRSCADCKAPDPDWASINLCVVICKKCAGQHRSLG
PKDSKVRSLKMDASIWSNELIELFIVIGNKRANDFWAGNLQKDEELHMDSPVEKRKNFIT
QKYKEGKFRKTLLASLTKEELNKALCAAVVKPDVLETMALLFSGADVMCATGDPVHSTPY
LLAKKAGQSLQMEFLYHNKFSDFPQHDVHSEGGSSQEAAQSTFLCDFLYQAPATASRVST
EKKLLEETNKKWCVLEGGFLSYYENDKCTTPNGTINISEVICLAVHKEDFYLNTGPIFVF
EIYLPSERVFLFGAETSQIQRKWTETIAKHFVPFVAENLTEADYDLIGQLFYKDCHALDQ
WRKGWFAMDKSSLCFCLQTQEAQEERMHLRRLQELTISTMVHNGEKLDVLLLVEKGRTLY
IHGHTKLDFTVWHTAIEKAAGTDGNALQDQQLCKNDVPIIVNSCIAFVTQYGLGCKHIYQ
KNGDSSHISELLESFKKDARSVKLRAGKHQLEDVTSVLKSFLSDIDDALLTKELYPYWVS
TLDIQDEKVRTEKYRAFIRTLPGVNRATLAAIIEHLYRVQKCSEINHMNAHNLALVFSSC
LFQTKGQTSEEVNVIEDLINNYVEIFEVKEDQVKQMDIENSFITKWKDTQVSQAGDLLIE
VFVERKEPDCSIIIRISPVMEAEELTSDILAIKNIVPTKGDVWATFEVIENEELERPLHY
TENVLEQVLQWSSLAEPGSAYLVVKRFLTVDTIKHCREKSVKEGALKLKEEPSKILSGNK
FQDRYIVLRDGHLFLYKDPKSSKHDKMFSLNLMKFYLGVKKKMKPPTSWGLTAYSEKHHW
HLCCDSLQAQMEWMASIFIAQHENDIWPPAGKERKRSITKNPKIGGLPLIPIQHERNATQ
ARKNIESARAELERLRLGEKHDRDFMDPSLKDRASIIAHCLEHKDDKLRNRARKHRSFNC
LEDTEAEIPHSLPKGFKGPKTLKKTEDRNSKTTLDPDHKLPSKVIEELSVVLQRSRTLPK
ELQDEQTSQKEIK
Download sequence
Identical sequences A0A1U7QA57
XP_005074448.1.91757 XP_012972011.1.91757 XP_012972012.1.91757 XP_012972013.1.91757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]