SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1U7R0M0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U7R0M0
Domain Number 1 Region: 496-734
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000000000000123
Family Protein kinases, catalytic subunit 0.01
Further Details:      
 
Domain Number 2 Region: 44-70
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000249
Family CCCH zinc finger 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1U7R0M0
Sequence length 884
Comment (tr|A0A1U7R0M0|A0A1U7R0M0_MESAU) Poly(A)-nuclease deadenylation complex subunit 3 {ECO:0000256|HAMAP-Rule:MF_03181} KW=Complete proteome; Reference proteome OX=10036 OS=Mesocricetus auratus (Golden hamster). GN=PAN3 OC=Muroidea; Cricetidae; Cricetinae; Mesocricetus.
Sequence
MNSGGGLPPPSAAASPSSSSLAAAVAVAVASGVGGVPGGPAAGVKLKYCRYYAKDKTCFY
GEECQFLHEDPASGAAPGLGLHSNSVPLALAAASGAGFPPGALPGGGAGPPVGPKKPELG
VPGAAATGGGGGGLDGPRLAIPGMDGGALTDTSLTDSYFSTSFIGVNGFGSPVETKYPLM
QRMTSSSSSPSLLNDSAKPYAGHDPLTSPASSLFNDFGALNISQRRKPRKCRLGMLEERL
VPMGSKARKAKNPIGCLADRCKSGVPINMVWWNRVTENNLQTPNPTASEFIPKGGSTSRL
SNVSQSNMSAFSQVFSHPSIGSPATAGLAPGMSLSAGSSPLHSPKITPHTSPAPRRRSHT
PNPASFMVPPSASTPANNPVPQTPSSGQVIQKETVGGTTYFYTDTTPAPVTGMVFPNYHI
YPPTAPHVAYMQPKANAPSFFMADELRQELINRHLITMAQIDQTDMPAVPTEVDSYHSLF
PLEPLPPPNRIQKSSNFGYITSCYKAVNSKDDLPYCLRRIHGFRLVNTKCMVLVDMWKKI
QHSNIVTLREVFTTKAFAEPSLVFAYDFHAGGETMMSRHFNDPNADGYFTKRKWGQHDGP
LPRQHAGLLPESLIWAYIVQLSSALRTIHTAGLACRVMDPTKILITGKTRLRVNCVGVFD
VLTFDNSQNNNPLALMAQYQQADLISLGKVVLALACNSLAGIQRENLQKAMELVTINYSS
DLKNLILYLLTDQNRMRSVNDIMPMIGARFYTQLDAAQMRNDVIEEDLAKEVQNGRLFRL
LAKLGTINERPEFQKDPTWSETGDRYLLKLFRDHLFHQVTEAGAPWIDLSHIISCLNKLD
AGVPEKISLISRDEKSVLVVTYSDLKRCFENTFQELIAAANGQL
Download sequence
Identical sequences A0A1U7R0M0
XP_005083238.1.91757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]