SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1U7RDX0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U7RDX0
Domain Number 1 Region: 35-148
Classification Level Classification E-value
Superfamily PH domain-like 1.52e-37
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.000048
Further Details:      
 
Domain Number 2 Region: 242-310,362-382
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 3.27e-21
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000133
Further Details:      
 
Domain Number 3 Region: 442-503
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00000000000458
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1U7RDX0
Sequence length 515
Comment (tr|A0A1U7RDX0|A0A1U7RDX0_MESAU) wiskott-Aldrich syndrome protein {ECO:0000313|RefSeq:XP_005085183.1} KW=Complete proteome; Reference proteome OX=10036 OS=Mesocricetus auratus (Golden hamster). GN=Was OC=Muroidea; Cricetidae; Cricetinae; Mesocricetus.
Sequence
MSGVPVGGRPAGRGGPAVQQNIPSNLLQDHENQRLFELLGRKCWTLATAVVQLYLALPPG
AEHWTMEHCGAVCFVKDNPQKSYFIRLYGLQAGRLLWEQELYSQLVYLTPTPFFHTFAGD
DCQVGLNFSDESEAQAFRALVQEKIQKRNQRQSGERRQLPPPPAPTNEERRGGLPPLPPH
PGGDHGGPSGSPISLGLVTVDIQNPDITSSRYRGLPAPGPGPADKKRSGKKKISKADIGA
PSGFKHVSHVGWDPQNGFDVNNLDPDLRSLFSRAGISEAQLTDAETSKLIYDFIEDQGGI
EAVRQEMRRQEPLPPPPPPCRGGGGGGGGGEGGGSQLLRPPIAGSNKGRSGPLPPVPGGG
APPPPTPRGPPPPGRGGPPPPPPPATGRSGPPPPPVPGAGGPPAPPPPPPPPPPPPPCTE
SGPAPPPLPPTSASARGPAPGGGRGALLDQIRQGIQLNKTPGAMENSVQQPPPQRSEGLV
GALMQVMQKRSRVIHSSDEGEDQTGEDEEDDEWDD
Download sequence
Identical sequences A0A1U7RDX0
XP_005085183.1.91757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]