SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1U7RER1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U7RER1
Domain Number 1 Region: 637-693
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.43e-20
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 2 Region: 525-582
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.04e-19
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 3 Region: 8-62
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.14e-19
Family KRAB domain (Kruppel-associated box) 0.002
Further Details:      
 
Domain Number 4 Region: 567-619
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.48e-17
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 5 Region: 678-730
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.55e-16
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 
Domain Number 6 Region: 488-539
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.95e-16
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 7 Region: 452-498
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000236
Family Classic zinc finger, C2H2 0.042
Further Details:      
 
Domain Number 8 Region: 239-287
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000324
Family Classic zinc finger, C2H2 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1U7RER1
Sequence length 762
Comment (tr|A0A1U7RER1|A0A1U7RER1_MESAU) zinc finger protein 786 isoform X3 {ECO:0000313|RefSeq:XP_005087228.1} KW=Complete proteome; Reference proteome OX=10036 OS=Mesocricetus auratus (Golden hamster). GN=Znf786 OC=Muroidea; Cricetidae; Cricetinae; Mesocricetus.
Sequence
MARPAPLPLTFEDVAVYFSEQEWQYLEAWQKELYKQVMRANYETLVSLDNGLPKPELISW
LELRRELFGTLGEEQKLGKGVRSSIDDVHLHPAIEEQLFESSQQAVKPRGTTCHLQLNPL
ESQHSFGLVLVEKEDVSFRQDQGVNLVDAQIRSLGALVSTVHSSNEAAQREALLSHRTPD
LSGLQKDPSRPSTQHSCPVCGENSWEKNHLVKRQKGHPKDPSHGVWKELGSQADAQQPWS
FSCPKRGSSFSPKQHLVGHLDAHTRKTPPQRPTCNVYFRREHALLSHHLKHNSSQRPKCD
ESFPTGSNVHQCQQSQERPASWREDTSVPSGQEPDPSPADYEGCCHEGGKPKKAPRCSCC
LGKGKPCSCAGCGSCFLSQSKQASLCRAHTGENSFRRPDGNECLQNVRGRVHSGESPGST
QRCKLTEHTQHLSRVKSSWCAQRGGNFGQRELRHQQLPPEGKPFRCTARESRFRPQGSLR
THQARRGPFSCSECGRAFAHPCKLREHLRVHSGERPFRCPECPKSFRLKGVLKAHQRTHS
QERPFSCGECGRGFTRRSKLTEHFRVHSGERPFRCPECGRGFRLKGQLLSHQRVHTGERP
FRCPECGRGYRVKADMKAHQLRHGGPMPFSCRCGKGFAKQSKLTEHARTHTGEKPFQCPQ
CDKRFRLKAQLLSHQGLHTGQRPFRCPECGKNFRERGHMLRHQRIHRPERPFACGHCGKG
FIYKSKLAEHARVHAKSGQVPRDASIKERLGQLFAMIEADWS
Download sequence
Identical sequences A0A1U7RER1
XP_005087228.1.91757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]