SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1U7S0D5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U7S0D5
Domain Number 1 Region: 546-591
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000392
Family TSP-1 type 1 repeat 0.00065
Further Details:      
 
Domain Number 2 Region: 45-93
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000157
Family TSP-1 type 1 repeat 0.0037
Further Details:      
 
Domain Number 3 Region: 107-139
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000105
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 4 Region: 496-535
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000838
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1U7S0D5
Sequence length 595
Comment (tr|A0A1U7S0D5|A0A1U7S0D5_ALLSI) complement component C9 {ECO:0000313|RefSeq:XP_006029008.1} KW=Complete proteome; Reference proteome OX=38654 OS=Alligator sinensis (Chinese alligator). GN=C9 OC=Alligator.
Sequence
MNVMLQLVPLLCVLESNIMVSGESRGSSETALHRDTRQLNAPSPIDCKLSSWSEWGPCDP
CLNQRFRSRSIVRFGQFGGRKCLESLGDTQKCNSNRACLEMEADCGADFTCDSGRCVKMR
LMCNVDNDCGDYSDENDCEAEPRSPCRNQDIDVSEIGRTAGHGINILGMQPMASPFENEY
FNGLCERVRDGNTKTYYRKPWNVAVLNYDTRADKSFTTESYHDRVEVFKEVLKTKQEYFE
YGMVLKLKPTEKTKEALNFSSGYKYSAEESFHSILHYDQERNQTFLLVKGKVQLGRFQMR
SRDVRLTDAFLDDLNFLPVEYDKGEYFRFLENYGTHYAVSGTVGGKYELVYVLDNYAMNL
KGIRVEDVKKCLGYHLDTSLVSKDLDYQLKIKGGKCENITITSTLEKKHDAVIDDVLSFV
DGGKIDFSVKIKEMLLRGAQVVDIQDYLQWATSLVDAPVVIQQRPSPIHTLVPVKMRDAH
TKKQNLERAIEDYVTEHSVCKCKPCQNGGTLVVIDGECICMCSSYFKGIACQIAKGKESE
AKQVTNGGWSCWTPWSPCVRGEHSRTRQCNNPDPGPGGKQCEGESIETSFCAEEL
Download sequence
Identical sequences A0A1U7S0D5
XP_006029008.1.24877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]