SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1U7T977 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U7T977
Domain Number 1 Region: 1051-1363
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.5e-111
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000000161
Further Details:      
 
Domain Number 2 Region: 1328-1616
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 8.43e-101
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000000619
Further Details:      
 
Domain Number 3 Region: 318-512
Classification Level Classification E-value
Superfamily Fibronectin type III 5.71e-47
Family Fibronectin type III 0.00055
Further Details:      
 
Domain Number 4 Region: 510-716
Classification Level Classification E-value
Superfamily Fibronectin type III 1.26e-37
Family Fibronectin type III 0.00075
Further Details:      
 
Domain Number 5 Region: 32-134
Classification Level Classification E-value
Superfamily Immunoglobulin 9.49e-19
Family I set domains 0.003
Further Details:      
 
Domain Number 6 Region: 230-323
Classification Level Classification E-value
Superfamily Immunoglobulin 4.51e-17
Family I set domains 0.013
Further Details:      
 
Domain Number 7 Region: 135-227
Classification Level Classification E-value
Superfamily Immunoglobulin 1.55e-16
Family I set domains 0.028
Further Details:      
 
Domain Number 8 Region: 722-811
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000671
Family Fibronectin type III 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1U7T977
Sequence length 1624
Comment (tr|A0A1U7T977|A0A1U7T977_TARSY) receptor-type tyrosine-protein phosphatase F isoform X1 {ECO:0000313|RefSeq:XP_008052933.1} KW=Complete proteome; Reference proteome OX=1868482 OS=Tarsius syrichta (Philippine tarsier). GN=PTPRF OC=Tarsiiformes; Tarsiidae; Carlito.
Sequence
MAPEPVPGRTMVPLVPALVMLGLVAGAHGDSKPVFIKVPEDQTGLSGGVASFVCQATGEP
KPRITWMKKGKKVSSQRFEVIEFDDGAGSVLRIQPLRVQRDEAIYECTATNSLGEINTSA
KLSVLEEEQLPPGFPSIDMGPQLKVVEKARTATMLCAAGGNPDPEISWFKDFLPVDPATS
NGRIKQLRSGALQIESSEESDQGKYECVATNSAGTRYSAPANLYVRVRRVAPRFSIPPSS
QEVMPGGSVNLTCVAVGAPMPYVKWMMGAEELTKEDEMPVGRNVLELSNVVRSANYTCVA
ISSLGMIEAMAQVTVKALPKPPIDLVVTETTATSVTLTWDSGNSEPVSYYGIQYRAAGTE
GPFQEVDGVATTRYSIGGLSPFSEYAFRVLAVNSIGRGPPSEAVRARTGEQAPSSPPRRV
QARMLSASTMLVQWEPPEEPNGLVRGYRVYYTPDSRRPLSAWHKHNTDAGLLTTVGSLLP
GITYSLRVLAFTAVGDGPPSPTIQVKTQQGVPAQPADFQAEVESDTRIQLSWLLPPQERI
IKYELVYWVAEDEDQQHKVTFDPTSSYTLEDLKPDTLYHFQLAARSDMGVGVFTPTIEAR
TAQSMPSGPPRKVEVEPLNSTAVHISWKLPVPSKQHGQIRGYQVTYVRLENGEPRGPPII
QDVMLAEAQWRPEESEDYETTISGLTPETTYSITVAAYTTKGDGARSKPKIVTTTGAVFA
KNFRVAAAMKTSVLLSWEVPDSYKSPVPFKILYNGQSVEVDGHSMRKLIADLQPNTEYSF
VLMNRGSSAGGLQHLVSIRTAPDLLPHKPLPASAYIEDGRFALSMPHVQDLSLVRWFYIV
VVPIDRVGGSMLAPRWSTPEELELNELLEAIEQGGEEQRQRRRRQAERLKPYVAAQMDVL
PETFTLGDKKNYRGFYNRPLSPDLSYQCFVLASLKEPVDQKRYASSPYSDEIVVQVTPAQ
QQEEPEMLWVTGPVLAVILIILIVIAILLFKRKRTHSPSSKDEQSVGLKDSLLAHSSDPV
EMRRLNYQTPGSSVPSCPNTSSMRDHPPIPITDLADNIERLKANDGLKFSQEYESIDPGQ
QFTWENSNLEVNKPKNRYANVIAYDHSRVILTSIDGVPGSDYINANYIDGYRKQNAYIAT
QGPLPETMGDFWRMVWEQRTATVVMMTRLEEKSRVKCDQYWPARGTETYGLIQVTLLDTV
ELATYTVRTFALHKSGSSEKRELRQFQFMAWPDHGVPEYPTPILAFLRRVKACNPLDAGP
MVVHCSAGVGRTGCFIVIDAMLERMKHEKTVDIYGHVTCMRSQRNYMVQTEDQYVFIHEA
LLEAATCGHTEVPARNLYAHIQKLGQVPPGESVTAMELEFKLLASSKAHTSRFISANLPC
NKFKNRLVNIMPYELTRVCLQPIRGVEGSDYINASFLDGYRQQKAYIATQGPLAESTEDF
WRMLWEHNSTIIVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFK
VTDARDGQSRTIRQFQFTDWPEQGVPKTGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGV
GRTGVFITLSIVLERMRYEGVVDMFQTVKTLRTQRPAMVQTEDQYQLCYRAALEYLGSFD
HYAT
Download sequence
Identical sequences A0A1U7T977
XP_008052933.1.4292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]