SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1U7TLB0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U7TLB0
Domain Number 1 Region: 453-510
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.52e-24
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 2 Region: 509-566
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.56e-24
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 3 Region: 201-258
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.77e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 4 Region: 565-622
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-22
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 5 Region: 397-454
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.45e-22
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 6 Region: 257-312
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.14e-21
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 7 Region: 316-370
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.51e-21
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 8 Region: 24-82
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.96e-21
Family KRAB domain (Kruppel-associated box) 0.00049
Further Details:      
 
Domain Number 9 Region: 163-215
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.07e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 10 Region: 611-663
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.91e-17
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 11 Region: 107-161
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000704
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 12 Region: 360-392
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000023
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1U7TLB0
Sequence length 666
Comment (tr|A0A1U7TLB0|A0A1U7TLB0_TARSY) zinc finger protein 709 {ECO:0000313|RefSeq:XP_008057193.1} KW=Complete proteome; Reference proteome OX=1868482 OS=Tarsius syrichta (Philippine tarsier). GN=LOC103261369 OC=Tarsiiformes; Tarsiidae; Carlito.
Sequence
MQVTKLVVTKVMQIAGLVTAQRGEQDSVVFEDVAVNFTQEEWALLGPSQKKLYRDVMQET
FVNLASIGEKWEDQNIEDHHKNQGRTLRSHMVEKLSEKNESSQLGETFSQTPNLKLNKKT
LTGVKPYECSVCGKAYMCHSSLNRHMRSHTEHRPYGYHKYGEKSYECKECGKRFNFRSSF
RIHERTHTGEKPYKCKQCGKAFSWPSSFQIHERTHTGEKPYECKECGKAFIYHTTFRGHM
RMHTGEKPYKCKECGKTFSHPSSFRNHERTHSGEKPYECKQCGKAFRYYQTFQIHERTHT
GEKPYQCKQCGKALSCPTSFRSHERIHTGEKPYKCKKCGKAFSFPSSFRKHERIHTGEKP
YDCKECGKAFISLPSFRRHMIMHTGNGPYKCKQCGKAFDCPSSFQIHERTHTGEKPYECK
QCGKAFSCSSSFRMHERTHTGEKPHECKQCGKAFSCSSSVRIHERTHTGEKPYECKQCGK
AFSCSSSFRMHERIHTGEKPYECKQCGKAFSFSSSFRMHERTHTGEKPYECKQCGKAFSC
SSSFRMHERTHTGEKPYECKQCGKAFSCSSSIRIHERTHTGEKPYECKQCGKAFSCSSSV
RMHERTHTGVKPYECKQCDKAFSCSRSFRIHERTHTGEKPYACQQCGKAFKCSRSFRIHE
RTHTGH
Download sequence
Identical sequences A0A1U7TLB0
XP_008057193.1.4292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]