SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1U7UGM8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U7UGM8
Domain Number 1 Region: 35-125
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 3.85e-37
Family SCAN domain 0.0000431
Further Details:      
 
Domain Number 2 Region: 471-528
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.69e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 3 Region: 584-641
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.42e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 4 Region: 630-682
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.27e-18
Family Classic zinc finger, C2H2 0.0023
Further Details:      
 
Domain Number 5 Region: 434-485
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.3e-18
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 6 Region: 211-266
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000000902
Family KRAB domain (Kruppel-associated box) 0.004
Further Details:      
 
Domain Number 7 Region: 517-559
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000239
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 8 Region: 376-417
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000769
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1U7UGM8
Sequence length 684
Comment (tr|A0A1U7UGM8|A0A1U7UGM8_TARSY) zinc finger protein 263 {ECO:0000313|RefSeq:XP_008069295.1} KW=Complete proteome; Reference proteome OX=1868482 OS=Tarsius syrichta (Philippine tarsier). GN=ZNF263 OC=Tarsiiformes; Tarsiidae; Carlito.
Sequence
MASGSGSQEREGLLIVKLEEDCAWSQELPLPNPAPSPEASHLRFRRFRFQEASGPREALN
RLQELCHGWLRPEMRTKEQILELLVLEQFLTILPQEIQSRVQELHPESGEEAVILVEDMQ
RELGRLRQQVTNHGRGSEVLLEEPLPLETARESPSFKLEPMETERSPGPRLQELLGPSPK
RDPQAVKERALSAPWLSLFPPEGNMEDKEMTGPQLPESLEDVAVYISQEEWGQQDPSKRA
LSRDTVQESYENVDSLGSHIHSQKVPSTQVVQGGKPWDPSVQSGKEGLSPRSPAPGEEKF
ENLEENARSVPPEHTHPQALLPGQVRGEVPWSPEQGRPRDRVEGDWEPSPEDRMEQSLAG
TISCGELGRSKELQPRKLHLCPLCGKNFSNNSNLIRHQRIHTAERLCMGVECSEVFGGNP
HFLSLHRAHLGEEAHKCLECGKCFSQNTHLTRHQRTHTGEKPYQCNICGKSFSCNSNLHR
HQRTHTGEKPYKCPECGEIFAHSSNLLRHQRIHTGERPYKCTECGKSFSRSSHLVIHERT
HEKERLYPFSECGAAMSDSIPFLTNRGAHKAEKKLFECLTCGKSFRQGMHLTRHQRTHTG
EKPYKCTLCGENFSHRSNLIRHQRIHTGEKPYTCHECGDSFSHSSNRIRHLRTHTGERPY
KCSECGESFSRSSRLMSHQRTHTG
Download sequence
Identical sequences A0A1U7UGM8
XP_008069295.1.4292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]