SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1U8BTX8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U8BTX8
Domain Number 1 Region: 1828-1908
Classification Level Classification E-value
Superfamily E set domains 6.3e-17
Family E-set domains of sugar-utilizing enzymes 0.018
Further Details:      
 
Domain Number 2 Region: 375-478
Classification Level Classification E-value
Superfamily Anthrax protective antigen 1.06e-16
Family Anthrax protective antigen 0.013
Further Details:      
 
Domain Number 3 Region: 3253-3305,3345-3535
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000000000314
Family Galacturonase 0.085
Further Details:      
 
Domain Number 4 Region: 2087-2175
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000112
Family Other IPT/TIG domains 0.061
Further Details:      
 
Domain Number 5 Region: 1913-1995
Classification Level Classification E-value
Superfamily E set domains 0.000000000000101
Family Other IPT/TIG domains 0.02
Further Details:      
 
Domain Number 6 Region: 1156-1233
Classification Level Classification E-value
Superfamily E set domains 0.000000000000165
Family E-set domains of sugar-utilizing enzymes 0.0088
Further Details:      
 
Domain Number 7 Region: 1998-2084
Classification Level Classification E-value
Superfamily E set domains 0.000000000000624
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.023
Further Details:      
 
Domain Number 8 Region: 1065-1141
Classification Level Classification E-value
Superfamily E set domains 0.00000000000101
Family E-set domains of sugar-utilizing enzymes 0.025
Further Details:      
 
Domain Number 9 Region: 1238-1317
Classification Level Classification E-value
Superfamily E set domains 0.0000000000056
Family E-set domains of sugar-utilizing enzymes 0.026
Further Details:      
 
Domain Number 10 Region: 1658-1741
Classification Level Classification E-value
Superfamily E set domains 0.0000000000127
Family E-set domains of sugar-utilizing enzymes 0.072
Further Details:      
 
Domain Number 11 Region: 270-361
Classification Level Classification E-value
Superfamily E set domains 0.0000000000177
Family E-set domains of sugar-utilizing enzymes 0.048
Further Details:      
 
Domain Number 12 Region: 1562-1623
Classification Level Classification E-value
Superfamily E set domains 0.000000000812
Family E-set domains of sugar-utilizing enzymes 0.031
Further Details:      
 
Domain Number 13 Region: 1329-1386
Classification Level Classification E-value
Superfamily E set domains 0.00000000178
Family E-set domains of sugar-utilizing enzymes 0.014
Further Details:      
 
Domain Number 14 Region: 1746-1822
Classification Level Classification E-value
Superfamily E set domains 0.00000000404
Family E-set domains of sugar-utilizing enzymes 0.018
Further Details:      
 
Domain Number 15 Region: 31-123
Classification Level Classification E-value
Superfamily E set domains 0.0000000204
Family E-set domains of sugar-utilizing enzymes 0.04
Further Details:      
 
Domain Number 16 Region: 142-239
Classification Level Classification E-value
Superfamily E set domains 0.0000000622
Family E-set domains of sugar-utilizing enzymes 0.023
Further Details:      
 
Domain Number 17 Region: 1404-1500
Classification Level Classification E-value
Superfamily Cupredoxins 0.00000134
Family Multidomain cupredoxins 0.047
Further Details:      
 
Domain Number 18 Region: 2485-2681
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000685
Family Galacturonase 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1U8BTX8
Sequence length 4252
Comment (tr|A0A1U8BTX8|A0A1U8BTX8_MESAU) fibrocystin-L {ECO:0000313|RefSeq:XP_012970711.1} KW=Complete proteome; Reference proteome OX=10036 OS=Mesocricetus auratus (Golden hamster). GN=Pkhd1l1 OC=Muroidea; Cricetidae; Cricetinae; Mesocricetus.
Sequence
MGHLWLPGTWFLLGLFRCADAGADGSETVPKVTEVIPKYGSMNGATRLTVKGEGFSQANQ
FNYGTDNTELGNRVQLVSSFQSITCDVEKDSSHSTQITCYTRAMPEDTYTVRVSVDGVPI
AENNTCKGLTSSWACSFSTKSFRTPTIRSITPLSGTPGTLITIQGRLFTDVYGSNTALSS
NGRNVRILRVYVGGMPCELLIPHSDDLYGLTLDQPSGDTGSMTCKMTGTYIGHHNASFIL
DSDYGRSFPEKMTYFVSSLNKISMFQTYAEITMMSPSKGSTQGGTTLTIHGRFFDQTDLP
VRALVGGQACDILNITENSIYCKTPPRPTILKTVYPGGRGLKLEVWNNSRPVHLEEIFEY
NEHTPGYMGASWIDSASYAWPMEKDTFVARFSGFLVPPDSDVYRFYIRGDDRYAIYFSQT
GRPEDKVRIAYHSANANSYFSSSTQRSDEIYLQRGKAYYIEILFQEYTLSAFVDVGLYQY
KNVFTEQQTGDAANEEQAIKSQSTVIPEVQIITLENWETTNATNEVQQVEVSSPCVGTNS
CSLSQYRFIYNMEKTVWLPADASDFALQSALNDLWSIKPDSVHVTSKRDLQRCIYTITFV
SVRGDFDLLGYEVFEGSNVTLDITEQTKGKPSLETFTLNWDGVPSKPLASESSEAEFQVA
VEEMVSAKCAPEISHLEEGFLVKYFRDYETDFDLDHINRGQKTSETDAYCGHCSLKNPAV
LFDSTDVKPNKLPYGDILLFPYNQFCLAYKGSLANYIGLKFKYQDSGKIIRSADKQFEYN
FSSGNKWTYTCIDLLDFLQTKYAGTSFSLQRIRLQKSSEFQSFYVDAVYIGQTPTVSALG
EVPKRRPPALANKGIFLKYFHVNKTKVNGSTMAIQYSVFMTLYNCSHNIPMMAVSFGQII
TNETKDESVYRGNNWPGESKIRIQKIREASPPISGSFDIQAYGHTLKGIPAAVSASDLQF
ALQSLEEIGRVSVRREGTCAGYTWTIAWKSPCGRQPLLQINDSNITGEKANVTVTTTKEG
GLFRQRIPGDMLRTPNQQPQVEVYVNGIPAKCSGDCRFTWDPMTTPLVLTTTPSEGSYAE
STILTIAGSGFSPTSAVSVSVGSTSCSLLSVNENEIKCQILNGSAGRVPVVVSNADGGLA
RNLEGEGSHFIYRTQINHVWPDSGSLAGGTLLTVSGFGFSENSTVLVGNETCSVIKGDLN
MITCRTPKRTEGTVDISVITNGIQATAKDGFSYSCLHTPVITEFSPKERAVLGDISLAIK
GYNFGNELAQNMVYVGGKACQVLHSNFTDISCLLPKLPPGKHDIYVNVRNWGLASTRNKL
NASIWYVLEVTHMFPQRGSLYGGTELTIEGSGFSRTPTENSVFLGSFPCDITSSSENVIK
CTLRSTGTVFRITNNGSHLEHGIGYAWSPSILNVTVGDTVVWHWQAYPFLRSIGYRVFSV
SSPGSVTYDGKGFTNGRQKSASGSFSHRFTSPGIHYYSSGYIDETHSVSLQGVINVLPAE
TRRIPLHLFVGNVEATYALADPQNLHLTSTAASCLATDPLCGLNDTRVKNPNQLLFELSS
CVSPSISNITPSSGTVNELITISGHGFSSLACANKVTIGSYPCVVEESSQNSITCHIDPQ
NSMDVGIREIVTLIIYNLGTAINTAPSEFDRQFVLLPNIDMVMPNEGSTTGMTRVTIQGS
GFMASSTSVEVFMGDFPCRVLTVTYTAIECETSPAPQQLVLVDLLIHGVPARCQGNCSFS
YLENIAPCVTRVSPNSIKGSVHVLIEGEGFGTVLEEVSIFIGSQQFSAVEVNENNITALV
TPLAAGLHSLRVVVGSKGLALGNVTISSPTVASVSPTSGSVAGGTTLTITGNGFSPGNTT
VTVGSNPCQIVFINSSEVYCSTPAGRAGTANLKISVKEVVYPPLSFTYTVEDTPFLKGIT
PNRGPPGTEVEIAGSNLGFDIGDVSVMIEDSACNVTTVNDSMLQCIVGEHAGGIFPVTML
HTTKGSALSSVVFEYPLYIQDIHPKQGSFGGGQTMTVTGTGFDPQNSSLLVCGSECAVDK
LGSDSKTLFCEIPPNNGSGPDQACGVSVVNGKDSSQSTVPFTYTLSLTPLVTEISPRRGS
TVGGTRLTVTGSGFSENTQDVHVSIANDKCDVQYSNKTHIICVTSPHAPSGWAPVQTSIR
NFGKAKVENPDFLYVDLWSANSSWGGKPPPEEGSLAVITEGQIILLDQSTPILKMLLIQG
GTLIFDEADIELQAENILITDGGVLQIGTEASPFQHQAVITLHGHLRSPELPVYGAKTLA
VREGTLDLHGLPVPVVWTRLAHTANAGERTLIVQEAVTWKAGDSLVIASTGHRHSQGENE
KRTIASVSADGTHITLTRPLNYTHLGISVTLPDGTEFEARAEVGILTRNILIRGSDNVEW
NDKIPSCPDGFDTGEFATQTCLQGKFGEEIGSDQFGGCIMLHAPLPGANMVTGRIEYVEV
FHAGQSFRLGRYPIHWHLLGDLQFKSYVRGCAIHQAYNRAVTIHNTHHLLVERNIIYDIK
GGAFFIEDGIEHGNILQYNLAIFVQQSTSLLNDDVTPAAFWVTNPNNTIRHNVAAGGTHF
GFWYRMNDHPDGPSYDRDICQKRIPLGEFANNTVHSQGWFGLWIFEEYFPMQTGSCTSTE
PVPAVFNSLTVWNCQKGAEWVNGGALQFHNFVVVNNQEAGIETKRILASYVGGWGEANGA
VIKNARIVGHLDELGMGSAFCTSKGLVLPFSQGLTVSSVRFMHFDRPDCVALGVTSITGV
CNDRCGGWSSKFVDIQYFHAPNKAGFRWEHEAALVDVDGSLTGHRGHTVIPHSSLLDPTH
CTQEAAWSLGFPGSVCDASVSFHRLAFNKPSPVSLLEKDVVLSDSFGTSIVPFQKKRLTH
MSGWMALIPNANHINWYFRGAEHLTNISYTSTFYGFKEEDYVIISHNFTQNPDVFNVVDM
RNGSSNPLNWNTSKNGDWHLEVNTSTLYYLVSGRSELPQSQPIPGTLDPDAKDVIINFQA
YCCVLQDCFPVHPPSRRPIPRTRPASYNLWSNESFWQSSPENNYTVPHPGANVVIPEGSW
IVADTDIPPMEKLIIWGVLELEDRSEVESATPSYRRVVLNATYISVQGGRLIGGWEDNPF
KGELQIVLRGNHSTPEWAFPEGPNQGAKVLGVFGELDLHGLPHSVYKTKLSETAEAGSRI
LSLVDAVDWQEGEDIVITTTSYDLHQTETRRIAKILHGHKILVLNDSLSYTHLAERQQIP
ETGQTYTLAADVGLLSRNIKIVGEDYPGWSRDSFGARILVGSLTGKMMTFKGNARISNVE
FYHSGQEGFRDSTDPRYAVTFLNLGQIQEHGLSYVRGCAFHHGFSPAIGVFGTDGLVIDD
NIIYFTVGEGIRIWGDANRVRGNLVTLSVWPGTYQNRKDLSSTLWHAAIEVNRGTNTVLQ
NNIVAGFGRAGYRIDGEPCSSQANPMENWFTNEAHGGLYGIYMNQDGLPGCSLIQGFTVW
TCWDYGIYFQTPDSVHIYNVTLVNNGMGIFPMIYMPPSVSHKISSKTVKIKNSLIVGSSP
EFNCSDVLTNDSPDVELTSAHRSSRPPSGGRSGICWPTFASAHNMAPRKPHAGIMSYNAI
SGLLDVSGSTFIGFKEACSGETNVIFITNPLNEDLQHPIHVKNVQLLDTTEQSKVFIHRP
DTSKVNPSDCVDMVCDAKRKSLLRDMDGSFLGSSGSVIPQAEYEWDGNSRLGIGDYRIPK
AMLTFLNGSRIPVTEKAPYKGIIRDSTCKYIPAWQSYRCSGMDYAMLVIESLDSDTETRR
LSPVAIVSNGYVDLISGPQDHGWCAGYTCQRRLSLFHSIMALNKMYEVYFTGTSPQNLRL
MLLNVEHNKAVLVGIFFSTLQRLDVYVNNSLVCPKNTAWNAQKKFCELDRHLNTEQLLPN
LSSTIPGENYFDRNYQMLYILVKGTTPVEVHTATVIFVSFQLPAVTEDDFFSSHNLVRNL
ALFLKIPNDKIRVSRIIGASLRRKRSAGRVMELEIGDAPAWFFQNSTAGQMQLSELQEIS
GTLGQAVILGKISTILGFNISSMSVTSPIPQPTDSGWIKVTAQPVERSAFPVHYMAFVSS
LSVVAQPVATQPGQPFPQQPSVKAVDHEGNCVSVGITSLTLKAILKDSNNNQVGGLGGNT
TIPFINCWANYTDLTLHRTGKNYKIEFILADMVRVESRTFSLAAQTVPGGGGSSPSSGSS
GGGHGKASAVGTPLQTLIVVAGCLVGRLLLLEVFMAAVFILNPATGSNSSAY
Download sequence
Identical sequences A0A1U8BTX8
XP_012970711.1.91757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]