SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1U8CPN7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U8CPN7
Domain Number 1 Region: 641-697
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.51e-20
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 2 Region: 529-586
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.06e-19
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 3 Region: 12-66
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.66e-19
Family KRAB domain (Kruppel-associated box) 0.002
Further Details:      
 
Domain Number 4 Region: 571-623
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.48e-17
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 5 Region: 682-734
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.54e-16
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 
Domain Number 6 Region: 492-543
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.13e-16
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 7 Region: 456-502
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000236
Family Classic zinc finger, C2H2 0.042
Further Details:      
 
Domain Number 8 Region: 243-291
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000324
Family Classic zinc finger, C2H2 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1U8CPN7
Sequence length 766
Comment (tr|A0A1U8CPN7|A0A1U8CPN7_MESAU) zinc finger protein 786 isoform X2 {ECO:0000313|RefSeq:XP_012981486.1} KW=Complete proteome; Reference proteome OX=10036 OS=Mesocricetus auratus (Golden hamster). GN=Znf786 OC=Muroidea; Cricetidae; Cricetinae; Mesocricetus.
Sequence
MGSTFMSRLLLPLTFEDVAVYFSEQEWQYLEAWQKELYKQVMRANYETLVSLDNGLPKPE
LISWLELRRELFGTLGEEQKLGKGVRSSIDDVHLHPAIEEQLFESSQQAVKPRGTTCHLQ
LNPLESQHSFGLVLVEKEDVSFRQDQGVNLVDAQIRSLGALVSTVHSSNEAAQREALLSH
RTPDLSGLQKDPSRPSTQHSCPVCGENSWEKNHLVKRQKGHPKDPSHGVWKELGSQADAQ
QPWSFSCPKRGSSFSPKQHLVGHLDAHTRKTPPQRPTCNVYFRREHALLSHHLKHNSSQR
PKCDESFPTGSNVHQCQQSQERPASWREDTSVPSGQEPDPSPADYEGCCHEGGKPKKAPR
CSCCLGKGKPCSCAGCGSCFLSQSKQASLCRAHTGENSFRRPDGNECLQNVRGRVHSGES
PGSTQRCKLTEHTQHLSRVKSSWCAQRGGNFGQRELRHQQLPPEGKPFRCTARESRFRPQ
GSLRTHQARRGPFSCSECGRAFAHPCKLREHLRVHSGERPFRCPECPKSFRLKGVLKAHQ
RTHSQERPFSCGECGRGFTRRSKLTEHFRVHSGERPFRCPECGRGFRLKGQLLSHQRVHT
GERPFRCPECGRGYRVKADMKAHQLRHGGPMPFSCRCGKGFAKQSKLTEHARTHTGEKPF
QCPQCDKRFRLKAQLLSHQGLHTGQRPFRCPECGKNFRERGHMLRHQRIHRPERPFACGH
CGKGFIYKSKLAEHARVHAKSGQVPRDASIKERLGQLFAMIEADWS
Download sequence
Identical sequences A0A1U8CPN7
XP_012981486.1.91757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]