SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1U8CSP4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U8CSP4
Domain Number 1 Region: 642-698
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.43e-20
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 2 Region: 9-67
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.59e-20
Family KRAB domain (Kruppel-associated box) 0.002
Further Details:      
 
Domain Number 3 Region: 530-587
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.06e-19
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 4 Region: 572-624
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.48e-17
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 5 Region: 683-735
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.52e-16
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 
Domain Number 6 Region: 493-544
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.13e-16
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 7 Region: 457-503
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000236
Family Classic zinc finger, C2H2 0.042
Further Details:      
 
Domain Number 8 Region: 244-292
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000324
Family Classic zinc finger, C2H2 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1U8CSP4
Sequence length 767
Comment (tr|A0A1U8CSP4|A0A1U8CSP4_MESAU) zinc finger protein 786 isoform X1 {ECO:0000313|RefSeq:XP_012981485.1} KW=Complete proteome; Reference proteome OX=10036 OS=Mesocricetus auratus (Golden hamster). GN=Znf786 OC=Muroidea; Cricetidae; Cricetinae; Mesocricetus.
Sequence
MTVSVQFLSLQLPLTFEDVAVYFSEQEWQYLEAWQKELYKQVMRANYETLVSLDNGLPKP
ELISWLELRRELFGTLGEEQKLGKGVRSSIDDVHLHPAIEEQLFESSQQAVKPRGTTCHL
QLNPLESQHSFGLVLVEKEDVSFRQDQGVNLVDAQIRSLGALVSTVHSSNEAAQREALLS
HRTPDLSGLQKDPSRPSTQHSCPVCGENSWEKNHLVKRQKGHPKDPSHGVWKELGSQADA
QQPWSFSCPKRGSSFSPKQHLVGHLDAHTRKTPPQRPTCNVYFRREHALLSHHLKHNSSQ
RPKCDESFPTGSNVHQCQQSQERPASWREDTSVPSGQEPDPSPADYEGCCHEGGKPKKAP
RCSCCLGKGKPCSCAGCGSCFLSQSKQASLCRAHTGENSFRRPDGNECLQNVRGRVHSGE
SPGSTQRCKLTEHTQHLSRVKSSWCAQRGGNFGQRELRHQQLPPEGKPFRCTARESRFRP
QGSLRTHQARRGPFSCSECGRAFAHPCKLREHLRVHSGERPFRCPECPKSFRLKGVLKAH
QRTHSQERPFSCGECGRGFTRRSKLTEHFRVHSGERPFRCPECGRGFRLKGQLLSHQRVH
TGERPFRCPECGRGYRVKADMKAHQLRHGGPMPFSCRCGKGFAKQSKLTEHARTHTGEKP
FQCPQCDKRFRLKAQLLSHQGLHTGQRPFRCPECGKNFRERGHMLRHQRIHRPERPFACG
HCGKGFIYKSKLAEHARVHAKSGQVPRDASIKERLGQLFAMIEADWS
Download sequence
Identical sequences A0A1U8CSP4
XP_012981485.1.91757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]