SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1U8CTN2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U8CTN2
Domain Number 1 Region: 558-615
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.94e-25
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 2 Region: 392-447
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.42e-23
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 3 Region: 502-559
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.13e-23
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 4 Region: 447-503
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.16e-23
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 5 Region: 614-671
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.86e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 6 Region: 54-114
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.48e-22
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 7 Region: 656-708
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.34e-19
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 8 Region: 352-404
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.55e-17
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 
Domain Number 9 Region: 296-347
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000265
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 10 Region: 234-278
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000348
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1U8CTN2
Sequence length 726
Comment (tr|A0A1U8CTN2|A0A1U8CTN2_MESAU) zinc finger protein 665 {ECO:0000313|RefSeq:XP_012979178.1} KW=Complete proteome; Reference proteome OX=10036 OS=Mesocricetus auratus (Golden hamster). GN=Znf665 OC=Muroidea; Cricetidae; Cricetinae; Mesocricetus.
Sequence
MQSVMLTCDSEQRAPDGGERGDSNKGSRRVPVFVPKTETQRKTTVMMAASPINAPQGLLT
FKNVTVDFSQEEWECLDSSQRALYMDVMWENYSNLVFVENHCICGKYEIVLNQGSKRIVH
EDVNTQEKSHKCYELGKMIHESSQCVPYNTSGATEDCKNYRGGTHKDTSTESSNRKRHRS
GKAVGEQCKHKDYRERLNVCSNISQSQQIHTGKKEHKDTDYDKLFDSKHELTMKLIQNGK
KPHQCRKCGKCFRTYLSLSKHQRTHPGERPYKFVDCDKSSLHLSHHKAQKTHCRGKPYKC
TECGKCFYHSSGFKRRCRNHTGEETYKCKNCRKSFICCSGLRKHQKIRGSERPYKCKQCN
KSFYTSSHLEYHYRRHSGEKLYKCNECGKSLSTSSGLKKHQRIHTGEKIYKCSDCGKSFT
FRTSLRLHQRIHTGEKPYKCNECGKCFIQKVNLRTHQTIHSGEKPFKCSECGKSFTVGSG
LRRHQTIHTGEKPYKCSKCGKSFPIVSDLRNHQKIHTGEKPHKCSECDKCFIWKADLRTH
QKVHTGEKPYKCGECGKSFTTGSGLRRHERIHTGERPYKCSECDKYFVQKTNLRRHQRIH
TGEKPYNCSECGKSFNTDSYLRIHQKIHTGERPYKCSECDKYFIQKAKLRIHQKIHTGEK
PYNCSECDKCFVQKGNLISHQRIHTGEKPYKCSGCDKSFTIGSVLRKHEKIHTGRNTLIL
YPGSQV
Download sequence
Identical sequences A0A1U8CTN2
XP_012979178.1.91757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]