SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1U8DC61 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U8DC61
Domain Number 1 Region: 359-481
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000011
Family Growth factor receptor domain 0.023
Further Details:      
 
Domain Number 2 Region: 231-352
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000361
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 3 Region: 186-233
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000272
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 4 Region: 146-195
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000247
Family EGF-type module 0.017
Further Details:      
 
Domain Number 5 Region: 113-154
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000364
Family EGF-type module 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1U8DC61
Sequence length 1612
Comment (tr|A0A1U8DC61|A0A1U8DC61_ALLSI) multiple epidermal growth factor-like domains protein 6 isoform X1 {ECO:0000313|RefSeq:XP_014378823.1} KW=Complete proteome; Reference proteome OX=38654 OS=Alligator sinensis (Chinese alligator). GN=MEGF6 OC=Alligator.
Sequence
MELHMLAQLFVFTLQASLLIYGNKLQPLMPNVCTEQELAIVGHQQPCVQAFTRMVKVWKQ
GCAGRLWCLGYERRTTYYTSYRQVYTMEYQTVYRCCPGWSQLGEDAGCFYPAVCSYGVCF
NGGNCMEGSAQLCQCPSGFQGPRCQYDVNECEVENGGCESQCCNTIGSFYCKCSSGLKLK
DDGKACEDVDECQVHNGGCQHRCVNTLGSYYCECKPGFRLHTDGRTCIAVNTCAVNNGGC
EHNCLQLTLTQHRCQCRHNYQLKEDGKHCILKSPCADRNGGCMHKCQNHRGMAHCECHPG
YRLAADNKACEDVNECATGLAMCAHSCLNTRGSFKCTCNPGYELGADGKQCYRIEMEIVN
SCEANNGGCSHLCRHTSSGPECTCNLGYQLDEDQKTCIDIDECESGSHCCQQDCSNSPGG
YECVCYAGYRLHTNGCGCDDVDECSSDNGGCEHTCQNQVGSFQCSCQIGYKLDEDRRSCI
SLGDSTEVLDGQRLIMYPLPHVAVLRDELTQLFEEDYEYDEEEMEARGEHTLSEKFVCLE
DTFGNDCSLTCDDCRNGGACNEERTGCDCPEGWSGILCNQTCPEGTFGRNCNFTCRCENG
GTCDPMTGTCRCPPGVSGELCEDGCPKGFFGKQCRKKCNCANRGRCHRIYGGCLCDPGLY
GRYCHLACPKWAYGPGCSEECLCVQQNTQDCDKKDGTCRCKPGYHGKRCQTKCDAGYYGI
GCKNNCNCHLGVACDHVSGECQKECPAGFYGENCDEGCPEGKFGVNCLQSCSCGGSPCDQ
ATGKCRCLPGKTGHDCGRVCPDGHWGVGCQEICPECENSASCDPATGACLCPPGYRGSRC
QDMCPAGWFGQGCQMRCSCGNDGHCHPTTGKCSCAPGWTGYNCRRACDAGHWGLDCANTC
NCSNSDGSCNLVTGQCICEAGYMGPHCDQKCPEGWFGLNCQHRCQCDNGAMCDHVSGACT
CSPGWRGTFCEHACPDGFYGLECQETCPCLNGAHCDHVTGRCTCPAGWLGLSCNQTCQDN
RYGENCSQLCSCFNNASCDPMSGQCLCAAGWTGATCQQACPQGFYGASCHQRCLCQNGGT
CNPVSGRCTCPEGWTGLACELDCAQGQYGMDCRQSCECHNGGLCDRQTGHCFCQAGWTGA
KCESPCPRGTFGEHCEEECDCGDGASCHPVTGVCDCPRGWRGQHCERACLPGSFGKDCAG
HCSCPPGTPCNHITGQCGCPPGFTGHGCERSCLPGTFGVNCAQVCHCPGANQDCDPITGE
CVCAPGYHGPRCQLRCSPGWYGSNCERQCQCKNEGHCATTTGACHCLAGYMGADCSISCP
AGRYGKNCAQLCSCGQGATCHPVTGTCICPAGRTGPRCEQACQKNRYGAGCKQTCTCQGR
GICRAADGSCLCGLGRTGMFCELECAPGMYGANCQLRCACQNNGTCDSVTGACHCTRGYY
GHLCEHSCPPGFHGLSCQELCDCHNGATCDPVTGRCLCPAGFYGAHCQTGCEAGKYGEGC
QRTCDCEGNVPCDPATGRCLCPPGKTGPKCDLDCRTNKYGPDCTMTCDCATFNSHCRAQN
GQCLCMNGYIGPTCREGGPPRLPAAQRSDAESGVPHRTPYHSLHGMFQRVHH
Download sequence
Identical sequences A0A1U8DC61
XP_014378823.1.24877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]