SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1U8DNL2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U8DNL2
Domain Number 1 Region: 358-480
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000104
Family Growth factor receptor domain 0.023
Further Details:      
 
Domain Number 2 Region: 185-230
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000157
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 3 Region: 230-352
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000173
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 4 Region: 150-194
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000208
Family EGF-type module 0.033
Further Details:      
 
Domain Number 5 Region: 112-153
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000525
Family EGF-type module 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1U8DNL2
Sequence length 1611
Comment (tr|A0A1U8DNL2|A0A1U8DNL2_ALLSI) multiple epidermal growth factor-like domains protein 6 isoform X2 {ECO:0000313|RefSeq:XP_014378830.1} KW=Complete proteome; Reference proteome OX=38654 OS=Alligator sinensis (Chinese alligator). GN=MEGF6 OC=Alligator.
Sequence
MELHMLAQLFVFTLQASLLIYGNKLQPLMPNVCTEQELAIVGHQQPCVQAFTRMVKVWKQ
GCAGRLWCLGYERRTTYYTSYRQVYTMEYQTVYRCCPGWSQLGEDAGCFYPVCSYGVCFN
GGNCMEGSAQLCQCPSGFQGPRCQYDVNECEVENGGCESQCCNTIGSFYCKCSSGLKLKD
DGKACEDVDECQVHNGGCQHRCVNTLGSYYCECKPGFRLHTDGRTCIAVNTCAVNNGGCE
HNCLQLTLTQHRCQCRHNYQLKEDGKHCILKSPCADRNGGCMHKCQNHRGMAHCECHPGY
RLAADNKACEDVNECATGLAMCAHSCLNTRGSFKCTCNPGYELGADGKQCYRIEMEIVNS
CEANNGGCSHLCRHTSSGPECTCNLGYQLDEDQKTCIDIDECESGSHCCQQDCSNSPGGY
ECVCYAGYRLHTNGCGCDDVDECSSDNGGCEHTCQNQVGSFQCSCQIGYKLDEDRRSCIS
LGDSTEVLDGQRLIMYPLPHVAVLRDELTQLFEEDYEYDEEEMEARGEHTLSEKFVCLED
TFGNDCSLTCDDCRNGGACNEERTGCDCPEGWSGILCNQTCPEGTFGRNCNFTCRCENGG
TCDPMTGTCRCPPGVSGELCEDGCPKGFFGKQCRKKCNCANRGRCHRIYGGCLCDPGLYG
RYCHLACPKWAYGPGCSEECLCVQQNTQDCDKKDGTCRCKPGYHGKRCQTKCDAGYYGIG
CKNNCNCHLGVACDHVSGECQKECPAGFYGENCDEGCPEGKFGVNCLQSCSCGGSPCDQA
TGKCRCLPGKTGHDCGRVCPDGHWGVGCQEICPECENSASCDPATGACLCPPGYRGSRCQ
DMCPAGWFGQGCQMRCSCGNDGHCHPTTGKCSCAPGWTGYNCRRACDAGHWGLDCANTCN
CSNSDGSCNLVTGQCICEAGYMGPHCDQKCPEGWFGLNCQHRCQCDNGAMCDHVSGACTC
SPGWRGTFCEHACPDGFYGLECQETCPCLNGAHCDHVTGRCTCPAGWLGLSCNQTCQDNR
YGENCSQLCSCFNNASCDPMSGQCLCAAGWTGATCQQACPQGFYGASCHQRCLCQNGGTC
NPVSGRCTCPEGWTGLACELDCAQGQYGMDCRQSCECHNGGLCDRQTGHCFCQAGWTGAK
CESPCPRGTFGEHCEEECDCGDGASCHPVTGVCDCPRGWRGQHCERACLPGSFGKDCAGH
CSCPPGTPCNHITGQCGCPPGFTGHGCERSCLPGTFGVNCAQVCHCPGANQDCDPITGEC
VCAPGYHGPRCQLRCSPGWYGSNCERQCQCKNEGHCATTTGACHCLAGYMGADCSISCPA
GRYGKNCAQLCSCGQGATCHPVTGTCICPAGRTGPRCEQACQKNRYGAGCKQTCTCQGRG
ICRAADGSCLCGLGRTGMFCELECAPGMYGANCQLRCACQNNGTCDSVTGACHCTRGYYG
HLCEHSCPPGFHGLSCQELCDCHNGATCDPVTGRCLCPAGFYGAHCQTGCEAGKYGEGCQ
RTCDCEGNVPCDPATGRCLCPPGKTGPKCDLDCRTNKYGPDCTMTCDCATFNSHCRAQNG
QCLCMNGYIGPTCREGGPPRLPAAQRSDAESGVPHRTPYHSLHGMFQRVHH
Download sequence
Identical sequences A0A1U8DNL2
XP_014378830.1.24877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]