SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1U8DNL7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U8DNL7
Domain Number 1 Region: 306-428
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000113
Family Growth factor receptor domain 0.023
Further Details:      
 
Domain Number 2 Region: 178-299
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000033
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 3 Region: 133-178
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000161
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 4 Region: 93-142
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000259
Family EGF-type module 0.017
Further Details:      
 
Domain Number 5 Region: 60-101
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000346
Family EGF-type module 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1U8DNL7
Sequence length 1559
Comment (tr|A0A1U8DNL7|A0A1U8DNL7_ALLSI) multiple epidermal growth factor-like domains protein 6 isoform X3 {ECO:0000313|RefSeq:XP_014378835.1} KW=Complete proteome; Reference proteome OX=38654 OS=Alligator sinensis (Chinese alligator). GN=MEGF6 OC=Alligator.
Sequence
MVKVWKQGCAGRLWCLGYERRTTYYTSYRQVYTMEYQTVYRCCPGWSQLGEDAGCFYPAV
CSYGVCFNGGNCMEGSAQLCQCPSGFQGPRCQYDVNECEVENGGCESQCCNTIGSFYCKC
SSGLKLKDDGKACEDVDECQVHNGGCQHRCVNTLGSYYCECKPGFRLHTDGRTCIAVNTC
AVNNGGCEHNCLQLTLTQHRCQCRHNYQLKEDGKHCILKSPCADRNGGCMHKCQNHRGMA
HCECHPGYRLAADNKACEDVNECATGLAMCAHSCLNTRGSFKCTCNPGYELGADGKQCYR
IEMEIVNSCEANNGGCSHLCRHTSSGPECTCNLGYQLDEDQKTCIDIDECESGSHCCQQD
CSNSPGGYECVCYAGYRLHTNGCGCDDVDECSSDNGGCEHTCQNQVGSFQCSCQIGYKLD
EDRRSCISLGDSTEVLDGQRLIMYPLPHVAVLRDELTQLFEEDYEYDEEEMEARGEHTLS
EKFVCLEDTFGNDCSLTCDDCRNGGACNEERTGCDCPEGWSGILCNQTCPEGTFGRNCNF
TCRCENGGTCDPMTGTCRCPPGVSGELCEDGCPKGFFGKQCRKKCNCANRGRCHRIYGGC
LCDPGLYGRYCHLACPKWAYGPGCSEECLCVQQNTQDCDKKDGTCRCKPGYHGKRCQTKC
DAGYYGIGCKNNCNCHLGVACDHVSGECQKECPAGFYGENCDEGCPEGKFGVNCLQSCSC
GGSPCDQATGKCRCLPGKTGHDCGRVCPDGHWGVGCQEICPECENSASCDPATGACLCPP
GYRGSRCQDMCPAGWFGQGCQMRCSCGNDGHCHPTTGKCSCAPGWTGYNCRRACDAGHWG
LDCANTCNCSNSDGSCNLVTGQCICEAGYMGPHCDQKCPEGWFGLNCQHRCQCDNGAMCD
HVSGACTCSPGWRGTFCEHACPDGFYGLECQETCPCLNGAHCDHVTGRCTCPAGWLGLSC
NQTCQDNRYGENCSQLCSCFNNASCDPMSGQCLCAAGWTGATCQQACPQGFYGASCHQRC
LCQNGGTCNPVSGRCTCPEGWTGLACELDCAQGQYGMDCRQSCECHNGGLCDRQTGHCFC
QAGWTGAKCESPCPRGTFGEHCEEECDCGDGASCHPVTGVCDCPRGWRGQHCERACLPGS
FGKDCAGHCSCPPGTPCNHITGQCGCPPGFTGHGCERSCLPGTFGVNCAQVCHCPGANQD
CDPITGECVCAPGYHGPRCQLRCSPGWYGSNCERQCQCKNEGHCATTTGACHCLAGYMGA
DCSISCPAGRYGKNCAQLCSCGQGATCHPVTGTCICPAGRTGPRCEQACQKNRYGAGCKQ
TCTCQGRGICRAADGSCLCGLGRTGMFCELECAPGMYGANCQLRCACQNNGTCDSVTGAC
HCTRGYYGHLCEHSCPPGFHGLSCQELCDCHNGATCDPVTGRCLCPAGFYGAHCQTGCEA
GKYGEGCQRTCDCEGNVPCDPATGRCLCPPGKTGPKCDLDCRTNKYGPDCTMTCDCATFN
SHCRAQNGQCLCMNGYIGPTCREGGPPRLPAAQRSDAESGVPHRTPYHSLHGMFQRVHH
Download sequence
Identical sequences A0A1U8DNL7
XP_014378835.1.24877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]