SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1U8DPT4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U8DPT4
Domain Number 1 Region: 457-514
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.63e-23
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 2 Region: 177-234
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-22
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 3 Region: 569-626
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.48e-22
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 4 Region: 513-570
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.5e-22
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 5 Region: 402-458
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.78e-21
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 6 Region: 290-346
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.14e-19
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 7 Region: 346-402
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.43e-19
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 8 Region: 4-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.54e-18
Family KRAB domain (Kruppel-associated box) 0.0018
Further Details:      
 
Domain Number 9 Region: 219-271
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.07e-16
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 10 Region: 611-663
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.66e-16
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 11 Region: 125-178
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000682
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 12 Region: 89-137
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000588
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1U8DPT4
Sequence length 672
Comment (tr|A0A1U8DPT4|A0A1U8DPT4_ALLSI) zinc finger protein 345-like {ECO:0000313|RefSeq:XP_014383212.1} KW=Complete proteome; Reference proteome OX=38654 OS=Alligator sinensis (Chinese alligator). GN=LOC102376018 OC=Alligator.
Sequence
LQEVFEDVAVYFTLKEWELLDDDDKVLYRDQMLKNFQALVSLGYQGPIPDLICSIQQGQV
ELWVSDEDGREISRSDLVKYLHVRREKHQYRCVKCSEAFTHFFSLSQHRYIHLGRKTHRC
TECKSFICRQNLSQHQCIQMGEQPYLCTKRVKRFRRAGHQRVHTGEKPHQCSECGKSFTY
SSTLSQHQLIHAGEKPHRCSECGKSFTWSSSLARHQLVHTEEKPHPCSECGKCFTFSSSL
AQHQSIHTGKKTNQCLQCGKSFNQSTDLAKHCLIHMVGKPHQCSECGKNFTYSSGLAQHK
HIHKGEKPHQCSECGKNFTYSSGLAQHKHIHKGEKPHQCSECGKNFTYSSGLAQHKHIHK
GEKPHQCSECGKNFTYSSGLAQHKHIHKGEKPHQCSECGKNFTYSSGLAQHKHIHKGEKP
HQCSECEKSFTYYSRLAEHQRVHTGEKPYRCSECGKSFARSSKLVWHQRVHTGEKPHQCS
ECGKSFTYSSTLSQHQLIHTGEKPHRCLECGRSFTWSSSLVRHQLIHKEEKPHQCSKCGK
CFTLSSSLAEHQHIHTGEKPYRCTECGKSFTRSSKLAWHQRIHTGEKPYRCTECGKSFNQ
SSNLAKHRLIHMMEKPYQCLECGKRFTQSYRLAQFQRIHTGEKPHPCSKCGKCFLHSSEL
ALHQCMPIYVCP
Download sequence
Identical sequences A0A1U8DPT4
XP_014383212.1.24877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]