SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1U8G5T5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U8G5T5
Domain Number 1 Region: 45-112
Classification Level Classification E-value
Superfamily Chaperone J-domain 0.0000000262
Family Chaperone J-domain 0.0032
Further Details:      
 
Domain Number 2 Region: 277-379
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000997
Family Thioltransferase 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1U8G5T5
Sequence length 711
Comment (tr|A0A1U8G5T5|A0A1U8G5T5_CAPAN) uncharacterized protein LOC107864802 {ECO:0000313|RefSeq:XP_016566711.1} KW=Complete proteome OX=4072 OS=Capsicum annuum (Bell pepper). GN=LOC107864802 OC=Capsiceae; Capsicum.
Sequence
MATPSVSRVPPKPSANSPLTSTLKAYFIPFILFSASLVYQLIVIPRAFPPSHYDALGITP
RSSIEEVNQAYEKLSSKWNSGVEVPSTIDFIKVRYAFELLTNHNWKRDYDLFSIDEQFAK
EQYAGRSISEITFPLLETIPFGPEDHAVDVINSENFLSKLETDKALLIQIFSLGSARCAQ
FSNEWKRIVTLLDGVANTGVIDLADVQLATYLAEKRPGGVPYFRHGIPALVAFSPGCRSF
RCMSRHEGELSIDSVTDWVATSILSLPRIRYYSKESMAQDFLLKSKPHKVKVIFFSQTGE
RATPFIRQAAKNYSAVATFAFVLWQEGESSLWWNMLGVESAPAIVFLKETGVKPVIHHGY
VNSSLFVDIMEKNKHQVLPQLRSVTSKELGCDARGFSRAGKDTKIWYCVVLVGRYSLELN
TMRETMRRVQETLSKDGELTAVDQDLSSAPALLALKQKRLTFTWLDGEAQKSYCFFYINS
EDSYETCGPRDMIDTAQLFIVRYDRNGTEDVGKQPTNKFSALYNVESDPASQLVAKYNGS
NKIEEIVQWISEIIKDGDSKDLPSFKSRTPELVPEDADSSWSSWTQGTVSPSGGLNHRVK
SLLNKIHDYIDDPRVGPFLLLAALISFGSVWFKRSQVAQSSKPNHSSQKSKEPEHLDHQT
SEPDQSNQPNAKDVTMRKRRTRPRNDLVPPSMTDVDPKDAYQVEFSDSDTG
Download sequence
Identical sequences A0A1U8G5T5
XP_016566711.1.72714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]