SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1V2LRP7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1V2LRP7
Domain Number 1 Region: 44-160
Classification Level Classification E-value
Superfamily Fumarate reductase respiratory complex transmembrane subunits 1.63e-28
Family Succinate dehydrogenase/Fumarate reductase transmembrane subunits (SdhC/FrdC and SdhD/FrdD) 0.0089
Further Details:      
 
Domain Number 2 Region: 282-357,453-506
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000334
Family SMI1/KNR4-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1V2LRP7
Sequence length 556
Comment (tr|A0A1V2LRP7|A0A1V2LRP7_PICKU) KNR4/SMI1 {ECO:0000313|EMBL:ONH76420.1} KW=Complete proteome OX=4909 OS=Pichia kudriavzevii (Yeast) (Issatchenkia orientalis). GN=BOH78_1129 OC=Saccharomycetes; Saccharomycetales; Pichiaceae; Pichia.
Sequence
MLRITNSSWAAFARSGVIRPTLHARSIVTVKTTDAEEQSILIAQRKNRPVSPHLEIYQKQ
LTAVLSALHRITGVGLAAGFYAVTVSYAAGVVDSASLVELYQSIPSVGQWALKGLASFPF
AFHAWNGVRHLIWDAGCEANIKGVYRTGYAVLGLSANSSMGFLGKKWKELVYTLTSNDRY
AGYHTSKAVNSLTEYDSEGEEANDAKEIQDNIPVTADEKQQAQLVLDAWHIIEDVINLDM
NNPDPNNNHFTLNSKNSQNYDYNYDMDFNLDLEEIPDAEDFMNSLSSPCTFKDLQVAQKH
LGVKFPYPVIKYFQTHDGQEVAPSSTKKLGLMYGLQLLSLAEVITMTNYWRKVARKEENS
KARLKAKADSISNDSKERPGSDDIINPQDDAIINNDPNFKIAAKINEITENDLKNYPDLM
RNMSTHSKTDYLKKLPNQKSFPANKVKLQYASANWIPLVTDNAGNHIAIDLDPDVDGMVG
QVIIFGRDYDTKYVVADNWGQFMSKFALDFEDPSNCKLDYDPDLGQFNLVYLDQSGNVVD
GGYLEVLTRRVKGERL
Download sequence
Identical sequences A0A1V2LRP7
XP_020545798.1.21716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]