SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1V5SYC6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1V5SYC6
Domain Number 1 Region: 3-102
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 6.45e-34
Family Canonical RBD 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1V5SYC6
Sequence length 103
Comment (tr|A0A1V5SYC6|A0A1V5SYC6_9EURY) RNA recognition motif {ECO:0000313|EMBL:OQA59354.1} OX=1852878 OS=Euryarchaeota archaeon ADurb.Bin294. GN=BWY45_00800 OC=Archaea; Euryarchaeota.
Sequence
MEGKKLYVGNLPYSTNESQLSELFSSYGEVVSAKIIENKGFGFVEMGTSEEAQAALDALN
DTEFDGRTMRIDEARPMQPRRDFGGNRSGGFGGSSGGFNRRRF
Download sequence
Identical sequences A0A1V5SYC6 Q2FLA6
323259.Mhun_0356 WP_011447420.1.85653 gi|88601667|ref|YP_501845.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]