SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1V9H4N8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1V9H4N8
Domain Number 1 Region: 218-263,311-366
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000131
Family SMI1/KNR4-like 0.019
Further Details:      
 
Domain Number 2 Region: 25-74,104-176
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000209
Family SMI1/KNR4-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1V9H4N8
Sequence length 372
Comment (tr|A0A1V9H4N8|A0A1V9H4N8_9XANT) Glucan biosynthesis protein {ECO:0000313|EMBL:OQP77730.1} KW=Complete proteome OX=1437878 OS=Xanthomonas phaseoli pv. syngonii LMG 9055. GN=IA54_007355 OC=Xanthomonadaceae; Xanthomonas.
Sequence
MAALKWMVYGRSPSLDTFWDEPLNLGRMPATEAAIAAAQARLGVRLPGWLLELYARYDGG
AVQMARGQSLEEPDNWLKAEWLVPRARLLGCADLFSFAEVRAGQDYRDDAYDGLAEGGDD
RRLIAIAADDRSPSRALCLDYSASDAEPALVYVDAGNKRRLAVFANVDDLLAQLVDVVYW
SPALQSRHDGDAVHWQPQPPAVTTFWSGPGHWNAQAAAADDEAFAAAEARLGVRLPALLK
RLYAVQDGGDTGWCWVPRTRFPSDRYADWECVLVDRDLPPLSHIRSVLDFANAFEDRTDF
SAAACLHAGLDRVLVLACHNVDSLLCLDYRARGPQHEPEVVYFETWDGLVPTWRAASFDA
FFGVLRQAELEL
Download sequence
Identical sequences A0A1V9H4N8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]