SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1V9YWU2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1V9YWU2
Domain Number 1 Region: 248-379
Classification Level Classification E-value
Superfamily Chaperone J-domain 3.93e-25
Family Chaperone J-domain 0.00014
Further Details:      
 
Domain Number 2 Region: 6-88
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000134
Family DIX domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1V9YWU2
Sequence length 382
Comment (tr|A0A1V9YWU2|A0A1V9YWU2_9STRA) Uncharacterized protein {ECO:0000313|EMBL:OQR90216.1} OX=74557 OS=Thraustotheca clavata. GN=THRCLA_09406 OC=Thraustotheca.
Sequence
MGTWAFYYLQAEDGEDRSHPNAYRIPAEAPVTLQDVQTHFPLGSASGFHFRFRVNSPKGD
TFFWLDVTSKAATVPLVNGRVICKVLRLDRPVKQGLILHKKPVVKVTPDAKPRQNNDRPA
KYSDKSSPPEPKPTPRPASAPPKAEAKSTESIEDFLSGPKPAPVAKEVDLMGSSNWSAPQ
APARPAPRAAAPAVSAPPKNFEDDGGQTVGPVTLAEMEEHKVSSDGTNVYNPDLVDKSTK
SAAVRAAMEARERAKAAEIERARQELLARDQAKNQLDNAKANAAVALGPKLKNWAEDNGR
KKNIRTLISTMHQIMWADSKWAEVNMGKLLTPNDVKKQYRRAIMVVHPDKAGGRTPEQLV
ISERVFDAINSAWDEFARTELK
Download sequence
Identical sequences A0A1V9YWU2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]