SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1V9ZB55 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1V9ZB55
Domain Number 1 Region: 276-386
Classification Level Classification E-value
Superfamily Chaperone J-domain 1.83e-24
Family Chaperone J-domain 0.00015
Further Details:      
 
Domain Number 2 Region: 6-87
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000403
Family DIX domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1V9ZB55
Sequence length 390
Comment (tr|A0A1V9ZB55|A0A1V9ZB55_9STRA) Uncharacterized protein {ECO:0000313|EMBL:OQR95157.1} OX=1202772 OS=Achlya hypogyna. GN=ACHHYP_00355 OC=Achlya.
Sequence
MAEGTWAFYYLQAEDGEDRSHPNAFRIPGAKEITLSDVHKHFPLGNPSGFHFRFRLNNGD
TFYWMDVASPSAVVPMVNGRVICKVLRLHRPTKKGLVLTRKPVYTLKGVAAPRTASSGPE
PKRPAKYSDTPVEPKTTSRPSAPAPKAAPKPQASGESFEDFLAGAPKTATPPVDLMDGGG
ATWSAPKATPPVRRPSPPPPPVSAPPKDFNDDCGQTVGPVTLADMDKHKVSADGSQVYNP
DLVDKSTKSDHVRAAMLQREADKAADIERARQELLARDQAKTQLEAAKASAVIALGPKLK
NWAEDNGRKKNIRTLISTMHQILWPDAKWAEVNMGKLLTPNDVKKQYRRAIMVVHPDKAG
GRTAEQLVIAERIFDAVNSAWDEFARTEMK
Download sequence
Identical sequences A0A1V9ZB55

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]