SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1W3JLL5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1W3JLL5
Domain Number 1 Region: 2-157
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 7.46e-30
Family CRAL/TRIO domain 0.0049
Further Details:      
 
Domain Number 2 Region: 323-451
Classification Level Classification E-value
Superfamily PapD-like 2.56e-23
Family MSP-like 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1W3JLL5
Sequence length 564
Comment (tr|A0A1W3JLL5|A0A1W3JLL5_CIOIN) motile sperm domain-containing protein 2-like {ECO:0000313|RefSeq:XP_009857583.1} OX=7719 OS=Ciona intestinalis (Transparent sea squirt) (Ascidia intestinalis). GN=LOC100181929 OC=Phlebobranchia; Cionidae; Ciona.
Sequence
MMKTGIVCCRGKANDNTRIVYFIVRKQTKDMKAKVQRMICLWLERIQRAEPGQHITFVMD
VSKSSLANVDLGGIKFLLTCFTTYFPDMLEKILILEMPWIMNTIWKVVKQWMTEDQRKRT
IFSSFKDLNQYIDADNALTYMGGKDDWEYSFPPYPNESPPIIMKQDSSSNFESDVISMAE
DNLEEEEIVVEDIEITQCSVIPTSSTESGYTSSGASASIPLVTTGQKMEILNDVDASRLN
SSTPKASPVKTNNRSQPMHLPNLDKENNSIPPMASITPSINIEKTNSVNLDSTYSGAKKN
KEVMKSDLSDPSKELPPSDEIINLGSLLTMSPVAEVIFKQSTKDSNTSRYRSNITLTNRC
KEEGMVVAFKVKTNSPERYHVKPSTGSLSTGEELTIRIHLSPGYEDTVSRDRFLILYQKM
EAGMDVAEFWKDHIDKSSRFEHRIRVRFEATSTNLRLEPPVVLKNSIETTKISKSPNKSP
IADEVAGLNRELARVKSQLGRAEESVEWIRSRFVYSLLLQSFLIVLLFLVIYKLSNITYI
LDRTENDPNGRYSNVVNPDEHTSL
Download sequence
Identical sequences A0A1W3JLL5
XP_009857583.1.78797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]