SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1W4XTP2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1W4XTP2
Domain Number 1 Region: 344-626
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.22e-60
Family Eukaryotic proteases 0.00055
Further Details:      
 
Domain Number 2 Region: 123-161
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000262
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 3 Region: 165-203
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000262
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 4 Region: 228-297
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000598
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 5 Region: 78-119
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000654
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 6 Region: 45-76
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000144
Family LDL receptor-like module 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1W4XTP2
Sequence length 638
Comment (tr|A0A1W4XTP2|A0A1W4XTP2_AGRPL) limulus clotting factor C-like isoform X1 {ECO:0000313|RefSeq:XP_018335833.1} KW=Complete proteome; Reference proteome OX=224129 OS=Agrilus planipennis (Emerald ash borer) (Agrilus marcopoli). GN=LOC108744517 OC=Elateriformia; Buprestoidea; Buprestidae; Agrilinae; Agrilus.
Sequence
MIRSGIVFITFWTVLVSRSSSVYIYDKYTIGNLTRFKRQSGCTGSFEFQCRSGECISDDY
YCDGKENCRDGSDETEDCKQIACLPHFFRCEYGACINGDFECDGKTDCKDNSDETSPKCL
KVSQCGPNKFRCNSGQCISDYNRCDGKPDCYDKSDETSEVCRELNCPGFTFKCAYGACVA
FTSKCNGRRDCADGSDEQGCKTVATTVTIPKVTTTTTKKPPIIVKDGCVLPDVPSNGGYN
VSGLSRFSVGDVVGHLTILQYYCNSGYQLYPNRLYIVCMTNDRWDKEFPDCMRRCPSLAP
TESTEVVCSLGNDSSKKMCENPIEGTIATFNCREFYERTDYLIKTTKCQGGSWNSYSIEC
TPACGKRGGIGQTNVVGGNIALKHDFPWHVGIYLSSDKTHICGGSIISSKFIVTAAHCLT
NLETGDLKPTSEFLVKVGKHYREYDDPRDSKYTQNTIIKSISKHRSYRGQTQNHQADLAI
IELQEPLKWTKYVQPICINWDPKYGNNDLGSDSGLVVGWGFTAETGAPADELKVLEVPHI
NFEKCYASVPDQFKPFVTPDKICAGFQKNGQSVCNGDSGGGLVFKKQYGYFGLRYILRGI
VSVSPKSNVTNGCDSNSFAGYTDLTVEEYIRYIIITIS
Download sequence
Identical sequences A0A1W4XTP2
XP_018335833.1.13287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]