SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1W4ZEE6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1W4ZEE6
Domain Number 1 Region: 470-699
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 1.31e-65
Family Hect, E3 ligase catalytic domain 0.000000507
Further Details:      
 
Domain Number 2 Region: 16-118
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.23e-28
Family Synaptotagmin-like (S variant) 0.031
Further Details:      
 
Domain Number 3 Region: 414-453
Classification Level Classification E-value
Superfamily WW domain 0.0000000000000282
Family WW domain 0.00024
Further Details:      
 
Domain Number 4 Region: 182-222
Classification Level Classification E-value
Superfamily WW domain 0.000000000000236
Family WW domain 0.0013
Further Details:      
 
Domain Number 5 Region: 364-401
Classification Level Classification E-value
Superfamily WW domain 0.00000000000167
Family WW domain 0.00079
Further Details:      
 
Domain Number 6 Region: 286-325
Classification Level Classification E-value
Superfamily WW domain 0.000000000362
Family WW domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1W4ZEE6
Sequence length 699
Comment (tr|A0A1W4ZEE6|A0A1W4ZEE6_9TELE) E3 ubiquitin-protein ligase NEDD4-like isoform X6 {ECO:0000313|RefSeq:XP_018598906.1} KW=Complete proteome OX=113540 OS=Scleropages formosus (Asian bonytongue). GN=LOC108929074 OC=Osteoglossomorpha; Osteoglossiformes; Osteoglossidae; Scleropages.
Sequence
MAEAVRELRGLPADEEQCRVLRVQVVAGIRLAKKDILGLSDPYTRITLYDLENDDSISIQ
TKTIKKTLDPKWNEEFFFSVHPQKHRLLFQVFDENRLTRDDFLGQVDIPLHQIPTETPDA
ARSNTFKDFVLHPRSYKSRVKGHLRLKMTYLPKHRSSEDDGAEQREEADLGWDFLEGQAG
PQHSAQPPPLPPGWEERQDNLGRTYYVNHRTRTTLWQRPTAQEEEQRQQTVQMVAQHAFL
ARRQISDPEDDHECLNSPRESFSAMSLEESPSNSESLLSSFPFIDQFLPSPLGLPPGWEE
RQDSRGCLYYINRISKKRTWSHPLANEAECLPQVPADVSHGPITSQASLVSPETPSQHAR
EAVQDINLMPPGWEIRSAPDGRPFFIDHNTKTTTWEDPRLKIPAHMGRRPSLDPSDLGPL
PPGWEERVYTDGRIFYIDHNTKITQWEDPRLQNAAITGPAVPYSRDYKQKYEYFCRKLKK
PNDTPNHFKMKLRRTAVLADSYRRIMSIKRADCLKTRLWIEFEGEKGLDYGGVSREWFFL
ISKEMFNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFKFIGRVAGMAVYHGKLLDAF
FIRPFYKMMLQKPITLQDMESVDSEYFNSLMWILENDPTDLDLRFTIDEELFGQTHQHEL
KPGGADIMVTDNNKKEYIHLVIQWRFVDRVQKQMSAFKE
Download sequence
Identical sequences A0A1W4ZEE6
XP_018598906.1.37976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]