SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1W4ZK62 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1W4ZK62
Domain Number 1 Region: 22-189
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 3.66e-41
Family CRAL/TRIO domain 0.0026
Further Details:      
 
Domain Number 2 Region: 253-387
Classification Level Classification E-value
Superfamily PapD-like 4.71e-37
Family MSP-like 0.00000253
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1W4ZK62
Sequence length 458
Comment (tr|A0A1W4ZK62|A0A1W4ZK62_9TELE) motile sperm domain-containing protein 2 isoform X4 {ECO:0000313|RefSeq:XP_018601173.1} KW=Complete proteome OX=113540 OS=Scleropages formosus (Asian bonytongue). GN=mospd2 OC=Osteoglossomorpha; Osteoglossiformes; Osteoglossidae; Scleropages.
Sequence
MMDESLQWRKEYGLNDLTEGSIPKWMFETGAVYLHGYDKEGNKLFWFKVKLHVKDARTFL
DKKKYVAFWLERYFRREPGMPLTVVFDMSESGFSNIDMEFVKYIVSCFRVYYPKMLSKMV
MYEMPFIMNAAWKIVRSWLGPDAISKLKFVSKSDIQTYIDVEHLPPHMGGTDPFRYSYPP
LLDDDFQSPISENGGLLSEDENESKDGETEPSSPLELSCNIEATCKPRKVNFVEENAKLE
EADKIDGANGSRSTRRPSTTFKGPLLHISPAEELCFEPKDKRKCLITLNNVTKNPVAFKV
RTTAPEKYRVKPSSSSCEPGASINIVVSLHGGSQASLQDRFLVMAAEMEQNAGAGPPDLA
QFWKEIPKARIMEHRMRCHVFESSKPTLSPLINSSPATEMNSHQDLQSMIMQVMASNSRL
EQKLNQCLWTQKVLMFLLSVFMALSFGFSLLYARQRIF
Download sequence
Identical sequences A0A1W4ZK62
XP_018601173.1.37976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]