SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1W4ZXN8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1W4ZXN8
Domain Number 1 Region: 27-139
Classification Level Classification E-value
Superfamily PH domain-like 5.8e-35
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0000562
Further Details:      
 
Domain Number 2 Region: 228-321
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 1.31e-24
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.000039
Further Details:      
 
Domain Number 3 Region: 441-502
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00000000955
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1W4ZXN8
Sequence length 513
Comment (tr|A0A1W4ZXN8|A0A1W4ZXN8_9TELE) wiskott-Aldrich syndrome protein {ECO:0000313|RefSeq:XP_018608412.1} KW=Complete proteome OX=113540 OS=Scleropages formosus (Asian bonytongue). GN=was OC=Osteoglossomorpha; Osteoglossiformes; Osteoglossidae; Scleropages.
Sequence
MSRGQKSKTQENSPSSLLSIQENERLVDLLGRRCVTLATAVVQLFMALPHSPLEWNLQHC
GVLCFVKDNPRRSYFIRLFDIKEGKQIWEQEVYNQMTYSSSHTFFHMFPADDCQVGLNFA
SEQEAELFRVTVEEKITQRNTRLEKRQLPPTPSSDDRRGPPPLPPPNGSTGHLEGMMTVD
IQNPDILASRYRSPAVPVPAHASLSKGKKDKKNKKKPKISKADIGAPSGFMHVTHVGWDP
NTGFDTNNLDPDLKKLFSCAGISEAQLTDAKTSKIIYDFIEQSGGLEAVKMEMRKQECAP
PPPPPDRGGLHASSAPPPPPTSRGRSGPLPPIPGQAMREPPRSPAPPSHRGALPPPPPAG
RTGPPPPPPPTATPSHRSAGAPPPPPPASSMTMGGGGGGGCPPPPPPPPPPPPAPSSGGP
PPPPPSSVGSAPPTRTASSGGGREALLDQIRLGKKLKNVTENPDPPPPVQDDSSEGIVGA
LMMVIQKRSKVIHSSEEEDEDGDDDDDDEWDDC
Download sequence
Identical sequences A0A1W4ZXN8
XP_018608412.1.37976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]