SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1W5A722 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1W5A722
Domain Number 1 Region: 527-573
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000379
Family TSP-1 type 1 repeat 0.00089
Further Details:      
 
Domain Number 2 Region: 102-139
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000196
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 3 Region: 44-91
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000955
Family TSP-1 type 1 repeat 0.0028
Further Details:      
 
Domain Number 4 Region: 481-520
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000887
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1W5A722
Sequence length 574
Comment (tr|A0A1W5A722|A0A1W5A722_9TELE) complement component C8 beta chain {ECO:0000313|RefSeq:XP_018609103.1} KW=Complete proteome OX=113540 OS=Scleropages formosus (Asian bonytongue). GN=c8b OC=Osteoglossomorpha; Osteoglossiformes; Osteoglossidae; Scleropages.
Sequence
MLLENTFKTGAQGGLLVAGLILSILCAAEGTSSYINPPASVEPVDCLLSEWSSWSRCDVC
LKKRYRYATLERPSQFGGEACHYHGREEEACEAPSRFSCRDTPPCDGFVCATTGRCVSRR
LRCNGDDDCGDSSDERGCKTVNWACKEKAEEYWGIESLAKGINTLTGNLEGIVLDNRYYA
GSCLPHYIRDTRFRKPYNLQHYTLETKGSYDFTLNTFESYSSFEEYRMKAHMSKTSVSFG
IKIPGIFEVSFNYNDEKYKKTIRKMRSFSGTQSSFLRAHSQLEVARYALKPADLMLHPGF
LERLRALPLDYSYGEYRQIFMDYGTHYITEATLGGEYEYSIVFNKENMEKSGYSLDDAKK
CVQAGFKVGLNIQGIYLSLGVEGGSCRSLLTELGDSKKEKKFVKDFVAVVKGGGSESITR
LVYRQLPTPEIMRDWGDSVFYNPDFIQTKMQPLFELVTSRDFVNAPTLKKNLNRALVEYL
AEASPCRCAPCLNNGMAVLKGTRCDCICPVGFSGTACEVTQRTDVAVDGGWSCWSPWSTC
SGRKKTRSRQCTNPASQNGGMTCSGTKEEEANCY
Download sequence
Identical sequences A0A1W5A722
XP_018609103.1.37976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]