SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1W5AQ53 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1W5AQ53
Domain Number 1 Region: 112-543
Classification Level Classification E-value
Superfamily Sema domain 4.05e-79
Family Sema domain 0.00086
Further Details:      
 
Domain Number 2 Region: 1418-1541,1707-1863
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.32e-34
Family p120GAP domain-like 0.025
Further Details:      
 
Domain Number 3 Region: 884-975
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000044
Family Other IPT/TIG domains 0.014
Further Details:      
 
Domain Number 4 Region: 979-1061
Classification Level Classification E-value
Superfamily E set domains 0.000000000024
Family Other IPT/TIG domains 0.016
Further Details:      
 
Domain Number 5 Region: 1067-1148
Classification Level Classification E-value
Superfamily E set domains 0.0000000000257
Family E-set domains of sugar-utilizing enzymes 0.047
Further Details:      
 
Domain Number 6 Region: 546-588
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000802
Family Plexin repeat 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1W5AQ53
Sequence length 1931
Comment (tr|A0A1W5AQ53|A0A1W5AQ53_9TELE) plexin-D1 {ECO:0000313|RefSeq:XP_018617759.1} KW=Complete proteome OX=113540 OS=Scleropages formosus (Asian bonytongue). GN=plxnd1 OC=Osteoglossomorpha; Osteoglossiformes; Osteoglossidae; Scleropages.
Sequence
MVQTHDSCAERSASPPVGTGFVPGSRLTRGVKSHPLWLRCAVNGRERPPPPRDFSQVQER
SDEDLQTEPDAALSSLRFPLPLPWERVLLCVQLLLHSHWSVRELPCDALHVQQAFRSPNR
TNNFVVDGGSGRLYLAAVNAIYQLDASLRVESEQPTGPVLDNVLCHAPQLPQAPCEHPKS
LTDNFNKLLQLDPQQRVLVACGSVYQGFCELRRMENISQIAVEFPPPGAKTVFPSMLNIA
ANDPNASTVGLVFRSHGGHAKLLVGATYTGVGTQFFPKNHSKEDLRFENTPEIAIRSLNI
KELPKLFTYDINPSEDNVFKIKQEVKQKNKLSFVHAFVQKSYSYIAINNDANLGHKESQP
NSILARICLDAESPRRASAESRKLTESYIQMFLQCGSNGNIYNRLVSVYPAEISVSPGAR
ARAPPHAQPYLFGVFSKAGRHTALCAFRFADIEEAIRQGRRNCSSSSSSEDVQVLDSVIQ
GSGAVCVQKGNIVLNLLPDLSVANQRSLKVAAGEPVHHIMTFDPSDRDYLYLMTSNHLLR
VKVSKCDQYGGCRECLSAGDAHCGWCTLQSRCSIRKECGSQLAHSWIGVGEGPQRCPSMT
ITPPDISIASDVENLGILINGSVPDLQGFAVECDYGPSGATAATVHSNGISVQIQTCSLL
PRVNFPRIPVGKDHVTVAVSVKVDGVPVVSGSFTLYDCEKTGTVHPKMECNSCLGTRWKC
YWDQEKNSCLFSKNTSEDLIPGVSTVESCPVMQSSEIPPSPSGRSQDIVVSLLNVNEGTA
LHCDFGGNQLYEAKWISPAEVKCMDVTLTTMEMSQVFHLNLRRRDFLDKYIDSPKPMRVE
VYNCGAGSADCSQCWGREDQGHLCAWCDNTCKPRDDCLPLRTQCPGPEIHQIMPLSGPLE
GGTLLTVQGKNLGRRVSDVNVAIGSIPCRLLHDRYTVSVQLVCVTGESRAELSDVVTVTV
DNAAVGSSKEAFSYLIPRVLSLEPSNGSLSGGTEVVIRGEHLNAGSRVRVRVNGTQDCAI
LLNDANAIECRMPAAENTRPETVPVCVEFEDLPCQNLQMSSFYSYEKNPIITTIQPQKSH
LSGGRTITVKGQGFNLVQTVDMEVRGIGIEQASCSVQSNTVIICSSPPSPESTQASVKFY
LNGVLYTGDRPVSQMDLEEEEEEEEDEEPYGTQFYMEYLEDPQFFTATKDKFIKHHPGEP
LTLIINKGPNALDLAPEEYSVTIGSVPCDISFSNDQLFHCTINGSLNSHEREQPVIVQVG
NFRKVIATVQLGGSELAIVVSIVVCSVLLLLCTVALVVYCTKSRRAERYWQKTLLQMEEM
ESQIREEIRKGFAELQTDMTDLTKELNRSQGIPFLDYKQFVMRTFFPKMCSDYEKSLLQP
IYENDNQAPRALPETHPLLQDWKPASTAKPNMEEGIALFSTLLNNKHFLITFVHALEQQK
DFAVRDRCSLASLLTIALHGKLEYFTSIMKELLVDLIDASASKNPKLMLRRTESVVEKML
TNWMSICMYSYLKETVGEPFFLLLCAIKQQINKGSIDAITGKARYTLNEEWLLRENIEAK
PQNINVSFQGFGMDSVTVRVMNTDTICQAKEKILEAFYKNLPFSQWPSADDVDLEWFASG
SNSRILMDLDNTSVMEDGRKKLNTVFHYKIPDGASLAMSLKDKRENSLGRAKDLDTEKYV
HLVLPNDELMETKKSHRHSHRKKVLPEIYLTRLLSTKGTLQKFLDDLFQAILSIPPDRPP
LAVKYFFDFLEEQADKRGITDPDTLHIWKTNSLPLRFWVNILKNPQFVFDIDKTDHMDAC
LSVIAQAFIDACSTSDLQLGKDSPTNKLLYAKEIPEYKKKVQWYYRQIQEMTPLSEQEMN
AHLAEESRKYRNEFNTNLALMEIYNYAKKYRNQVANALDANPTARRTQLQHKFEQVIALV
EDNIYECSSEA
Download sequence
Identical sequences A0A1W5AQ53
XP_018617759.1.37976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]