SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1W5BB48 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1W5BB48
Domain Number 1 Region: 3-145
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000000000119
Family APC10-like 0.021
Further Details:      
 
Domain Number 2 Region: 374-392,435-646
Classification Level Classification E-value
Superfamily ARM repeat 0.000000838
Family PBS lyase HEAT-like repeat 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1W5BB48
Sequence length 916
Comment (tr|A0A1W5BB48|A0A1W5BB48_CIOIN) centrosomal protein of 104 kDa isoform X2 {ECO:0000313|RefSeq:XP_018668059.1} OX=7719 OS=Ciona intestinalis (Transparent sea squirt) (Ascidia intestinalis). GN=LOC100187042 OC=Phlebobranchia; Cionidae; Ciona.
Sequence
MPSKIGYSVVGSTGEAEGYGAKNLEHQNPTIPGWQTPRFCVYPQELIIRMNERTNVKKLQ
LLAHQFMIPSKIEFFVGTNESADSFKRLGYIYLSNNEKTGFKARELKSVHVDADGHFLRL
VVHKNHMNKFNLYNQVGIMAFNVIGDGISKRHPLKPISSGTTNPLNYSIEGSINKPDYIS
PMDDLAFDMYQDPEVAGIIRKLDVKKQKAVIAENFDVAKRMKQAIADLQKVGEKLARYEL
DKRRAVEHEDYDLAKSKKSQMDEYRLKVYQQLQKYNLLEDAGISPVKQNGEQPLQQVQEP
QPSPRRVISEPIVSPRPQPSPPPMESPSLFVPHEEIASPRLEPPQEQIQEKVASPEPVAT
YSPRVRHSPAIYDEKVIPALVKHKDPDPFLEDEVPSPRQEFSPDKPSAPSGEPEAMSEKS
IREASSVIDVFGLPLVSGAYSKTWSFREDALLAVYKLLSNAPETISKDELKSHLRAAIFL
IRRAIKDKVHAVFHASLRLLELILVDFVPKHKLGKVETVHAVSRTLPNLIQKTGETAARS
RNAAIEFIDRMSEFAMVHQYQLVAQQATPPFKRDMAMRLALSRVEILERLFTKFGLEPPV
LTVETGMKFASQALSHSSGSVRDAATRIIFLLYKIAGNAVKAYLPPDDNTTRKNPLYRNI
FDGFDRISGKLTQSELKAQQQAKAAESERKKKQEIEDLQSQVNQLRQMNNMVANEQVQQP
AVGKKSKKSTTKPPPPPAEEASPNKAGDENDSTYLENMCIFCGERDDAFTEEGLDLHYWK
HCPLLKKCEHCKQVVEVAGYCGHLLTECDKKSEFGECPRCKEAIPLTDLDKHVADKRCTA
AKPGLDHCPLCHKNIALGEESWKSHLMGVKRDACLENPRRQPSINRLRAKEESEKAAAAG
KGKKSGVGNVKKQQRR
Download sequence
Identical sequences A0A1W5BB48
XP_018668059.1.78797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]