SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1W5BLC3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1W5BLC3
Domain Number 1 Region: 367-490
Classification Level Classification E-value
Superfamily Growth factor receptor domain 8.95e-16
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 2 Region: 237-360
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000146
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 3 Region: 157-201
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000493
Family EGF-type module 0.02
Further Details:      
 
Domain Number 4 Region: 191-250
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000921
Family EGF-type module 0.01
Further Details:      
 
Domain Number 5 Region: 117-161
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000168
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1W5BLC3
Sequence length 1612
Comment (tr|A0A1W5BLC3|A0A1W5BLC3_CIOIN) multiple epidermal growth factor-like domains protein 6 {ECO:0000313|RefSeq:XP_018671256.1} OX=7719 OS=Ciona intestinalis (Transparent sea squirt) (Ascidia intestinalis). GN=LOC100184792 OC=Phlebobranchia; Cionidae; Ciona.
Sequence
MIKNRRNSRLLAATSLVFIFFCLDDTAATNLQMGMPNVCESESVKVVRSVQPCVKAFTRL
VKVWKQSCGDYRRWCVGYERRTAYYTTYRTSYQTKKSTSAKCCPGWTQMNNEAGCSYPHC
SYGVCFNGGRCQDSATQMCQCTGGFTGARCENDLNECATNNGGCNQMCCNSFGGFFCKCR
EGFHLQSDQRTCVDDDECSEHNGGCAHVCVNTEGGHYCECNEGYRLHIDDKTCVPTNMCE
IRNGGCEQICEAQGTSGRYSCRCQRGYVINSNGRTCDVADPCETNNGGCNQNCVAVGFEA
QCTCFEGYELDADNRTCIDVNECLTNLGGCSHNCVNTIGSYTCICNPGYELGRDSQTCYR
IEMEVIKSCSTMNGGCMHTCNEDLGVITCSCSSGFQLEADSKSCTDVDECSDGTKCCDQG
CSNTPGGYECSCRSGFTMLSDGCGCQDINECLDLNGGCDQQCVNSVGSYECACDGGFVLS
ADGKLCEPLPPVIVFRPQPQPVHSLTLNGGEPDLAAFALVTRCEPGRFGADCRFTCSDCP
QGNCNDDLDGCDCSAGHHGIVCNETCAEGRYGPNCREQCNCLNEGKCDPETGECRCMPGV
TGTRCENGCPRGKFGSNCEKFCNCRGARCHKTFGICFCEPGRYGRRCHKACPPWSFGMIC
KNECRCNKRHSFGCDKADGTCHCKPGYTGRTCTSACAEGTFGADCAERCRCEDGVGCDHV
TGACQRDCPPGFRGQNCTQECSAGTWGVGCLEICSCAAGSQCDRITGRCICGPGKTGITC
EKECPGNTWGLGCSHTCTCLNNGVCNKETGDCECAPGFVGVLCADRCRIGRYGRQCRNRC
NCGNGICDPIDGTCRCNPGYAGRNCQKTCGLGFWGQNCAVRCDCENGEPCDPVTGTCNCA
SGWLGRRCDQRCPEGFYGPQCQQECMCVNGATCDHVSGACTCTSGWRNTFCDRACPDGYY
GLDCGNTCACWNGARCNHITGDCSCPAGWVGDSCSERCGENRWGENCTNVCNCANGASCD
HVTGRCICGLGFTGARCDRSCPEGYFGANCQRMCTCRNSRGCDPVTGRCNCEPGWIGIAC
EQECGVGTFGDGCSASCNCHNNGMCDFATGVCRCTPGWQGPSCLEGCPDGFFGDKCKEKC
SCENGVGCDHITGRCLCNAGWRGSTCSRPCLAGQFGERCESKCTCAAGLPCHHVTGACSC
PTGLTGSSCQNVCPPGRFGDNCAETCSCGRNSQCDPRTGVCSCAPGYTGEDCNTRCQDGF
YGSNCRSICLCRNGGTCEPISGRCTCQPGYTGSTCNDECPVGFYGSGCSRACDCGSGAVC
DKVTGSCPTAPTCDAGKMGNNCQSVCEPGTWGVNCANQCTCSNNGVCNAVTGNCLCGLGW
TGAMCDTECVSGTWGPDCSMECSCNLNETCDRFNGWCHCSPGYFGVECQLSCPKGFYGAG
CRSQCDCQNSVNCDPVTGRCHCSTGWHGAQCENSCPTGKYGANCLMSCDCGSSNKCDSIS
GECKCPAGYTGPKCQNVCSSGRYGPGCSLNCNCEHGGVCDPMNGSCTCTLGWTGAKCQQK
GMFARVRTSSRTHHRARVSNRRSRLSALRRLRERTLSTFSQIKRRRQLFTRT
Download sequence
Identical sequences A0A1W5BLC3
XP_018671256.1.78797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]