SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1W5CAR3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1W5CAR3
Domain Number 1 Region: 3-379
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.25e-100
Family Cystathionine synthase-like 0.000000313
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1W5CAR3
Sequence length 389
Comment (tr|A0A1W5CAR3|A0A1W5CAR3_9NOST) Cysteine desulfurase {ECO:0000313|EMBL:OBQ02050.1} OX=1710890 OS=Anabaena sp. 39858. GN=AN489_27975 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Anabaena.
Sequence
MQIYLDYSATTPTCTEAIAVMQSVLTQQWGNPSSLHEWGQRATTIVEQARVQVAGLINAA
NPESIIFTSGGTEANNLAIMGVVRMQNVPQHIIISSVEHSAISEPANLLEKWGWEVTRLG
VDNTGRVNPEDLKAALRHNTVLVSVIYGQSEIGTVQPIAELGKITQQHGALFHTDAVQAV
GRLPIDVQQLPVDLLSLSSHKLYGPQGVGALYIRPGVELLPLLNGGGQERGLRSGTQAVP
IIAGFGVAAEIAAEELSIEIPRLMKLRDRLFAQLADVPGLIPTGDRENRLPHHVSFYLEQ
ADGEKLSGKTLVRHLNLAGIGISAGAACHSGKLSPSPILLAMGYSTKAALGGIRLTLGRE
TTAADVDWTAMVLKQILQRLVPGELVISH
Download sequence
Identical sequences A0A1W5CAR3 Q3M3I3
gi|75911052|ref|YP_325348.1| 240292.Ava_4856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]